StarFunc result for job id P24592

User Input

>input (240 residues)
MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEA
EGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKES
KPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYR
GAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P24592	1.000	1.000	1.271E-44	240	1.000	1.000	P24592.pdb.gz	IBP6_HUMAN Insulin-like growth factor-binding protein 6 OS=Homo sapiens OX=9606 GN=IGFBP6 PE=1 SV=1
2	AFDB:P47880	0.504	0.508	2.401E-29	238	0.700	0.706	P47880.pdb.gz	IBP6_MOUSE Insulin-like growth factor-binding protein 6 OS=Mus musculus OX=10090 GN=Igfbp6 PE=2 SV=2
3	AFDB:P17936	0.319	0.266	3.702E-16	291	0.350	0.289	P17936.pdb.gz	IBP3_HUMAN Insulin-like growth factor-binding protein 3 OS=Homo sapiens OX=9606 GN=IGFBP3 PE=1 SV=2
4	AFDB:I6XXP7	0.334	0.297	1.085E-15	291	0.354	0.292	I6XXP7.pdb.gz	I6XXP7_BOVIN Insulin-like growth factor-binding protein 3 OS=Bos taurus OX=9913 GN=IgFBp3 PE=4 SV=1
5	AFDB:Q66I28	0.321	0.283	1.690E-15	292	0.388	0.318	Q66I28.pdb.gz	Q66I28_DANRE Insulin-like growth factor-binding protein 3 OS=Danio rerio OX=7955 GN=IGFBP-3 PE=2 SV=1
6	AFDB:Q90WV8	0.316	0.288	5.622E-15	265	0.358	0.325	Q90WV8.pdb.gz	IBP5_XENLA Insulin-like growth factor-binding protein 5 OS=Xenopus laevis OX=8355 GN=igfbp5 PE=2 SV=1
7	AFDB:P24593	0.320	0.286	7.241E-15	272	0.362	0.320	P24593.pdb.gz	IBP5_HUMAN Insulin-like growth factor-binding protein 5 OS=Homo sapiens OX=9606 GN=IGFBP5 PE=1 SV=1
8	AFDB:A0A0B5JK49	0.309	0.285	3.521E-14	262	0.308	0.282	A0A0B5JK49.pdb.gz
9	AFDB:P47877	0.275	0.234	3.996E-14	305	0.321	0.252	P47877.pdb.gz	IBP2_MOUSE Insulin-like growth factor-binding protein 2 OS=Mus musculus OX=10090 GN=Igfbp2 PE=2 SV=2
10	AFDB:P13384	0.266	0.204	5.841E-14	317	0.354	0.268	P13384.pdb.gz	IBP2_BOVIN Insulin-like growth factor-binding protein 2 OS=Bos taurus OX=9913 GN=IGFBP2 PE=1 SV=2
11	PDB:7wrqB	0.225	0.317	2.664E-9	167	0.233	0.335	7wrqB.pdb.gz
12	PDB:5irxF	0.122	0.354	9.339E-1	75	0.042	0.133	5irxF.pdb.gz	TRPV1 structures in nanodiscs reveal mechanisms of ligand and lipid action.
13	PDB:5epmC	0.114	0.683	2.125	33	0.025	0.182	5epmC.pdb.gz
14	PDB:2m9lA	0.074	0.456	3.107	35	0.017	0.114	2m9lA.pdb.gz
15	PDB:2kniA	0.138	0.675	4.001	41	0.033	0.195	2kniA.pdb.gz
16	PDB:5iy6U	0.082	0.102	4.263	170	0.021	0.029	5iy6U.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
17	PDB:5z56v	0.084	0.109	5.154	167	0.033	0.048	5z56v.pdb.gz	Structure of the human activated spliceosome in three conformational states.
18	PDB:7ls6M	0.069	0.091	5.490	160	0.033	0.050	7ls6M.pdb.gz
19	PDB:5ahjL	0.071	0.076	6.637	222	0.033	0.036	5ahjL.pdb.gz	Macyranones: Structure, Biosynthesis, and Binding Mode of an Unprecedented Epoxyketone that Targets the 20S Proteasome.
20	PDB:6epcA	0.079	0.077	6.637	246	0.033	0.033	6epcA.pdb.gz	In Situ Structure of Neuronal C9orf72 Poly-GA Aggregates Reveals Proteasome Recruitment.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P24592	2.48e-172	475	240	1.000	1.000	IBP6_HUMAN Insulin-like growth factor-binding protein 6 OS=Homo sapiens OX=9606 GN=IGFBP6 PE=1 SV=1
2	P47880	6.50e-103	300	238	0.658	0.664	IBP6_MOUSE Insulin-like growth factor-binding protein 6 OS=Mus musculus OX=10090 GN=Igfbp6 PE=2 SV=2
3	P35572	6.40e-89	264	226	0.617	0.655	IBP6_RAT Insulin-like growth factor-binding protein 6 OS=Rattus norvegicus OX=10116 GN=Igfbp6 PE=1 SV=1
4	Q07079	5.82e-38	135	271	0.371	0.328	IBP5_MOUSE Insulin-like growth factor-binding protein 5 OS=Mus musculus OX=10090 GN=Igfbp5 PE=1 SV=1
5	Q90WV8	9.73e-38	134	265	0.362	0.328	IBP5_XENLA Insulin-like growth factor-binding protein 5 OS=Xenopus laevis OX=8355 GN=igfbp5 PE=2 SV=1
6	P24594	2.98e-37	133	271	0.367	0.325	IBP5_RAT Insulin-like growth factor-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Igfbp5 PE=1 SV=1
7	P24593	6.10e-37	132	272	0.354	0.312	IBP5_HUMAN Insulin-like growth factor-binding protein 5 OS=Homo sapiens OX=9606 GN=IGFBP5 PE=1 SV=1
8	B3GS77	6.77e-37	132	271	0.354	0.314	B3GS77_SHEEP Insulin-like growth factor-binding protein 5 OS=Ovis aries OX=9940 GN=IGFBP5 PE=2 SV=1
9	Q05717	1.28e-36	132	271	0.354	0.314	IBP5_BOVIN Insulin-like growth factor-binding protein 5 OS=Bos taurus OX=9913 GN=IGFBP5 PE=2 SV=2
10	P47878	6.45e-31	117	292	0.312	0.257	IBP3_MOUSE Insulin-like growth factor-binding protein 3 OS=Mus musculus OX=10090 GN=Igfbp3 PE=2 SV=2
11	I6XXP7	2.94e-30	115	291	0.338	0.278	I6XXP7_BOVIN Insulin-like growth factor-binding protein 3 OS=Bos taurus OX=9913 GN=IgFBp3 PE=4 SV=1
12	P20959	2.94e-30	115	291	0.338	0.278	IBP3_BOVIN Insulin-like growth factor-binding protein 3 OS=Bos taurus OX=9913 GN=IGFBP3 PE=1 SV=3
13	P15473	6.74e-30	114	292	0.304	0.250	IBP3_RAT Insulin-like growth factor-binding protein 3 OS=Rattus norvegicus OX=10116 GN=Igfbp3 PE=1 SV=2
14	P17936	7.03e-30	114	291	0.338	0.278	IBP3_HUMAN Insulin-like growth factor-binding protein 3 OS=Homo sapiens OX=9606 GN=IGFBP3 PE=1 SV=2
15	Q66I28	1.20e-26	106	292	0.379	0.312	Q66I28_DANRE Insulin-like growth factor-binding protein 3 OS=Danio rerio OX=7955 GN=IGFBP-3 PE=2 SV=1
16	Q9PTH3	4.97e-26	104	276	0.333	0.290	IBP2A_DANRE Insulin-like growth factor-binding protein 2-A OS=Danio rerio OX=7955 GN=igfbp2a PE=1 SV=1
17	B3F211	4.44e-21	90.9	265	0.300	0.272	IBP2B_DANRE Insulin-like growth factor-binding protein 2-B OS=Danio rerio OX=7955 GN=igfbp2b PE=1 SV=1
18	Q8JHX6	9.04e-21	90.1	262	0.292	0.267	Q8JHX6_DANRE Insulin-like growth factor-binding protein 1 OS=Danio rerio OX=7955 GN=igfbp1a PE=2 SV=1
19	A4K8J2	3.58e-20	88.2	244	0.275	0.270	A4K8J2_DANRE Insulin-like growth factor-binding protein 1 OS=Danio rerio OX=7955 GN=igfbp1b PE=2 SV=1
20	P22692	3.96e-20	88.2	258	0.321	0.298	IBP4_HUMAN Insulin-like growth factor-binding protein 4 OS=Homo sapiens OX=9606 GN=IGFBP4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00219 IGFBP	0.003	29.4	Insulin-like growth factor binding protein
2	PF00086 Thyroglobulin_1	9.6e-15	65.3	Thyroglobulin type-1 repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301464

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000391826	0.996	Insulin-like growth factor II
2	9606.ENSP00000302665	0.954	Insulin-like growth factor I
3	9606.ENSP00000441875	0.916	Prohibitin-2
4	9606.ENSP00000416683	0.827	Insulin-like growth factor-binding protein complex acid labile subunit
5	9606.ENSP00000301466	0.821	Sterol O-acyltransferase 2
6	9606.ENSP00000447173	0.784	Vitamin D3 receptor
7	9606.ENSP00000268035	0.677	Insulin-like growth factor 1 receptor
8	9606.ENSP00000370473	0.665	Insulin-like growth factor-binding protein 3
9	9606.ENSP00000295666	0.655	Insulin-like growth factor-binding protein 7
10	9606.ENSP00000310861	0.641	Keratin, type II cytoskeletal 2 epidermal
11	9606.ENSP00000233813	0.612	Insulin-like growth factor-binding protein 5
12	9606.ENSP00000363826	0.577	Frizzled-8
13	9606.ENSP00000357051	0.567	Peroxisomal biogenesis factor 19
14	9606.ENSP00000349437	0.553	Cation-independent mannose-6-phosphate receptor
15	9606.ENSP00000388510	0.531	Retinoic acid receptor gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031995	0.999	insulin-like growth factor II binding
GO:0042802	0.998	identical protein binding
GO:0005102	0.998	signaling receptor binding
GO:0031994	0.486	insulin-like growth factor I binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0048519	0.966	negative regulation of biological process
GO:0048523	0.957	negative regulation of cellular process
GO:0048518	0.930	positive regulation of biological process
GO:0009966	0.916	regulation of signal transduction
GO:0048522	0.913	positive regulation of cellular process
GO:0042127	0.880	regulation of cell population proliferation
GO:0043408	0.871	regulation of MAPK cascade
GO:0043410	0.863	positive regulation of MAPK cascade
GO:0009968	0.843	negative regulation of signal transduction
GO:0050896	0.822	response to stimulus
GO:0030111	0.805	regulation of Wnt signaling pathway
GO:0060828	0.803	regulation of canonical Wnt signaling pathway
GO:0016477	0.798	cell migration
GO:0090090	0.781	negative regulation of canonical Wnt signaling pathway
GO:0070302	0.772	regulation of stress-activated protein kinase signaling cascade
GO:0008285	0.698	negative regulation of cell population proliferation
GO:0051716	0.682	cellular response to stimulus
GO:0032872	0.660	regulation of stress-activated MAPK cascade
GO:0070304	0.598	positive regulation of stress-activated protein kinase signaling cascade
GO:0007165	0.507	signal transduction
GO:0019222	0.465	regulation of metabolic process
GO:0032502	0.403	developmental process
GO:0080090	0.375	regulation of primary metabolic process
GO:0032874	0.355	positive regulation of stress-activated MAPK cascade
GO:0060255	0.316	regulation of macromolecule metabolic process
GO:0032501	0.311	multicellular organismal process
GO:0051171	0.307	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0032991	0.991	protein-containing complex
GO:0070013	0.959	intracellular organelle lumen
GO:0012505	0.941	endomembrane system
GO:0043227	0.940	membrane-bounded organelle
GO:0043231	0.871	intracellular membrane-bounded organelle
GO:0005737	0.852	cytoplasm
GO:0031982	0.511	vesicle
GO:0016942	0.407	insulin-like growth factor binding protein complex
GO:0042568	0.383	insulin-like growth factor binary complex
GO:0071944	0.377	cell periphery
GO:0070062	0.306	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]