StarFunc result for job id P24593

User Input

>input (272 residues)
MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCA
LAEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHE
EPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRIISA
PEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGI
CWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P24593	1.000	1.000	6.006E-53	272	1.000	1.000	P24593.pdb.gz	IBP5_HUMAN Insulin-like growth factor-binding protein 5 OS=Homo sapiens OX=9606 GN=IGFBP5 PE=1 SV=1
2	AFDB:Q90WV8	0.727	0.744	5.863E-36	265	0.625	0.642	Q90WV8.pdb.gz	IBP5_XENLA Insulin-like growth factor-binding protein 5 OS=Xenopus laevis OX=8355 GN=igfbp5 PE=2 SV=1
3	AFDB:P17936	0.568	0.537	4.275E-27	291	0.460	0.430	P17936.pdb.gz	IBP3_HUMAN Insulin-like growth factor-binding protein 3 OS=Homo sapiens OX=9606 GN=IGFBP3 PE=1 SV=2
4	AFDB:P15473	0.629	0.590	2.235E-24	292	0.423	0.394	P15473.pdb.gz	IBP3_RAT Insulin-like growth factor-binding protein 3 OS=Rattus norvegicus OX=10116 GN=Igfbp3 PE=1 SV=2
5	AFDB:I6XXP7	0.334	0.314	9.380E-24	291	0.404	0.378	I6XXP7.pdb.gz	I6XXP7_BOVIN Insulin-like growth factor-binding protein 3 OS=Bos taurus OX=9913 GN=IgFBp3 PE=4 SV=1
6	AFDB:Q66I28	0.324	0.303	1.387E-23	292	0.434	0.404	Q66I28.pdb.gz	Q66I28_DANRE Insulin-like growth factor-binding protein 3 OS=Danio rerio OX=7955 GN=IGFBP-3 PE=2 SV=1
7	AFDB:P22692	0.497	0.519	4.485E-23	258	0.375	0.395	P22692.pdb.gz	IBP4_HUMAN Insulin-like growth factor-binding protein 4 OS=Homo sapiens OX=9606 GN=IGFBP4 PE=1 SV=2
8	AFDB:M4Q8Z6	0.345	0.380	1.889E-19	245	0.305	0.339	M4Q8Z6.pdb.gz	M4Q8Z6_SALSA Insulin-like growth factor-binding protein 1 OS=Salmo salar OX=8030 GN=IGFBP-1B1 PE=2 SV=1
9	AFDB:P13384	0.322	0.279	3.870E-19	317	0.320	0.274	P13384.pdb.gz	IBP2_BOVIN Insulin-like growth factor-binding protein 2 OS=Bos taurus OX=9913 GN=IGFBP2 PE=1 SV=2
10	AFDB:B3F211	0.549	0.561	5.723E-19	265	0.301	0.309	B3F211.pdb.gz	IBP2B_DANRE Insulin-like growth factor-binding protein 2-B OS=Danio rerio OX=7955 GN=igfbp2b PE=1 SV=1
11	PDB:7wrqB	0.424	0.631	7.910E-16	167	0.368	0.599	7wrqB.pdb.gz
12	PDB:5epmC	0.099	0.642	9.166E-1	33	0.029	0.242	5epmC.pdb.gz
13	PDB:7nacm	0.095	0.043	2.004	666	0.096	0.039	7nacm.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
14	PDB:5irxF	0.102	0.339	2.602	75	0.033	0.120	5irxF.pdb.gz	TRPV1 structures in nanodiscs reveal mechanisms of ligand and lipid action.
15	PDB:1wzvA	0.100	0.142	3.164	150	0.048	0.087	1wzvA.pdb.gz
16	PDB:7qp6y	0.104	0.049	6.481	697	0.066	0.026	7qp6y.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.
17	PDB:4q5eC	0.100	0.121	6.918	155	0.044	0.077	4q5eC.pdb.gz
18	PDB:2l3aA	0.084	0.242	7.384	82	0.022	0.073	2l3aA.pdb.gz
19	PDB:4oe5D	0.086	0.055	7.881	507	0.037	0.020	4oe5D.pdb.gz
20	PDB:6v8oG	0.070	0.307	8.412	53	0.015	0.075	6v8oG.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3GS77	0.0	543	271	0.967	0.970	B3GS77_SHEEP Insulin-like growth factor-binding protein 5 OS=Ovis aries OX=9940 GN=IGFBP5 PE=2 SV=1
2	P24593	0.0	560	272	1.000	1.000	IBP5_HUMAN Insulin-like growth factor-binding protein 5 OS=Homo sapiens OX=9606 GN=IGFBP5 PE=1 SV=1
3	P24594	0.0	530	271	0.938	0.941	IBP5_RAT Insulin-like growth factor-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Igfbp5 PE=1 SV=1
4	Q05717	0.0	542	271	0.967	0.970	IBP5_BOVIN Insulin-like growth factor-binding protein 5 OS=Bos taurus OX=9913 GN=IGFBP5 PE=2 SV=2
5	Q07079	0.0	535	271	0.945	0.948	IBP5_MOUSE Insulin-like growth factor-binding protein 5 OS=Mus musculus OX=10090 GN=Igfbp5 PE=1 SV=1
6	Q90WV8	1.64e-123	354	265	0.654	0.672	IBP5_XENLA Insulin-like growth factor-binding protein 5 OS=Xenopus laevis OX=8355 GN=igfbp5 PE=2 SV=1
7	P17936	3.97e-70	219	291	0.441	0.412	IBP3_HUMAN Insulin-like growth factor-binding protein 3 OS=Homo sapiens OX=9606 GN=IGFBP3 PE=1 SV=2
8	P47878	5.00e-65	206	292	0.415	0.387	IBP3_MOUSE Insulin-like growth factor-binding protein 3 OS=Mus musculus OX=10090 GN=Igfbp3 PE=2 SV=2
9	I6XXP7	1.23e-64	206	291	0.434	0.405	I6XXP7_BOVIN Insulin-like growth factor-binding protein 3 OS=Bos taurus OX=9913 GN=IgFBp3 PE=4 SV=1
10	P20959	1.23e-64	206	291	0.434	0.405	IBP3_BOVIN Insulin-like growth factor-binding protein 3 OS=Bos taurus OX=9913 GN=IGFBP3 PE=1 SV=3
11	P15473	1.28e-64	206	292	0.412	0.384	IBP3_RAT Insulin-like growth factor-binding protein 3 OS=Rattus norvegicus OX=10116 GN=Igfbp3 PE=1 SV=2
12	Q66I28	1.50e-59	192	292	0.423	0.394	Q66I28_DANRE Insulin-like growth factor-binding protein 3 OS=Danio rerio OX=7955 GN=IGFBP-3 PE=2 SV=1
13	P22692	6.86e-47	159	258	0.375	0.395	IBP4_HUMAN Insulin-like growth factor-binding protein 4 OS=Homo sapiens OX=9606 GN=IGFBP4 PE=1 SV=2
14	P47879	6.82e-44	151	254	0.390	0.417	IBP4_MOUSE Insulin-like growth factor-binding protein 4 OS=Mus musculus OX=10090 GN=Igfbp4 PE=1 SV=2
15	P21744	9.61e-44	150	254	0.386	0.413	IBP4_RAT Insulin-like growth factor-binding protein 4 OS=Rattus norvegicus OX=10116 GN=Igfbp4 PE=1 SV=2
16	Q9GK32	2.59e-42	141	69	0.250	0.986	Q9GK32_SHEEP Insulin-like growth factor binding protein 5 (Fragment) OS=Ovis aries OX=9940 GN=IGFBP-5 PE=2 SV=1
17	Q90YJ7	1.39e-39	140	262	0.327	0.340	Q90YJ7_DANRE Insulin-like growth factor-binding protein 1 OS=Danio rerio OX=7955 GN=IGFBP-1 PE=2 SV=1
18	Q8JHX6	6.27e-39	138	262	0.301	0.313	Q8JHX6_DANRE Insulin-like growth factor-binding protein 1 OS=Danio rerio OX=7955 GN=igfbp1a PE=2 SV=1
19	P47876	8.15e-39	138	272	0.335	0.335	IBP1_MOUSE Insulin-like growth factor-binding protein 1 OS=Mus musculus OX=10090 GN=Igfbp1 PE=2 SV=2
20	M4Q8Z6	4.72e-37	133	245	0.301	0.335	M4Q8Z6_SALSA Insulin-like growth factor-binding protein 1 OS=Salmo salar OX=8030 GN=IGFBP-1B1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00219 IGFBP	1.9e-08	46.1	Insulin-like growth factor binding protein
2	PF00086 Thyroglobulin_1	8e-16	68.7	Thyroglobulin type-1 repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000233813

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302665	0.999	Insulin-like growth factor I
2	9606.ENSP00000391826	0.996	Insulin-like growth factor II
3	9606.ENSP00000356634	0.979	Pappalysin-2
4	9606.ENSP00000330658	0.967	Pappalysin-1
5	9606.ENSP00000416683	0.944	Insulin-like growth factor-binding protein complex acid labile subunit
6	9606.ENSP00000346839	0.943	Fibronectin type III domain containing
7	9606.ENSP00000226218	0.914	Vitronectin
8	9606.ENSP00000378517	0.909	Osteopontin
9	9606.ENSP00000223095	0.871	Plasminogen activator inhibitor 1
10	9606.ENSP00000386665	0.845	Four and a half LIM domains protein 2
11	9606.ENSP00000370473	0.784	Insulin-like growth factor-binding protein 3
12	9606.ENSP00000349547	0.717	Ras association domain-containing protein 1
13	9606.ENSP00000377710	0.693	Four and a half LIM domains protein 1
14	9606.ENSP00000268035	0.685	Insulin-like growth factor 1 receptor
15	9606.ENSP00000447173	0.672	Vitamin D3 receptor
16	9606.ENSP00000295666	0.669	Insulin-like growth factor-binding protein 7
17	9606.ENSP00000301464	0.612	Insulin-like growth factor-binding protein 6
18	9606.ENSP00000393847	0.612	Group 10 secretory phospholipase A2
19	9606.ENSP00000349437	0.603	Cation-independent mannose-6-phosphate receptor
20	9606.ENSP00000260356	0.594	Thrombospondin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031994	0.999	insulin-like growth factor I binding
GO:0005102	0.333	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.990	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0032502	0.978	developmental process
GO:0048519	0.976	negative regulation of biological process
GO:0051716	0.968	cellular response to stimulus
GO:0023052	0.954	signaling
GO:0007154	0.954	cell communication
GO:0042221	0.919	response to chemical
GO:0007165	0.910	signal transduction
GO:0010033	0.898	response to organic substance
GO:0048523	0.892	negative regulation of cellular process
GO:0048518	0.866	positive regulation of biological process
GO:0043434	0.786	response to peptide hormone
GO:0048522	0.777	positive regulation of cellular process
GO:0019222	0.765	regulation of metabolic process
GO:0010646	0.763	regulation of cell communication
GO:0023051	0.751	regulation of signaling
GO:0060255	0.739	regulation of macromolecule metabolic process
GO:0080090	0.688	regulation of primary metabolic process
GO:0031323	0.681	regulation of cellular metabolic process
GO:0048856	0.607	anatomical structure development
GO:0051171	0.605	regulation of nitrogen compound metabolic process
GO:0032501	0.604	multicellular organismal process
GO:0014070	0.592	response to organic cyclic compound
GO:0042127	0.531	regulation of cell population proliferation
GO:0048583	0.524	regulation of response to stimulus
GO:0009966	0.505	regulation of signal transduction
GO:0007568	0.499	aging
GO:0007275	0.499	multicellular organism development
GO:0030334	0.459	regulation of cell migration
GO:0010468	0.437	regulation of gene expression
GO:0030335	0.433	positive regulation of cell migration
GO:0009889	0.425	regulation of biosynthetic process
GO:0031326	0.424	regulation of cellular biosynthetic process
GO:0010556	0.423	regulation of macromolecule biosynthetic process
GO:0009892	0.421	negative regulation of metabolic process
GO:0010605	0.403	negative regulation of macromolecule metabolic process
GO:0050793	0.391	regulation of developmental process
GO:0051246	0.385	regulation of protein metabolic process
GO:0051239	0.378	regulation of multicellular organismal process
GO:0048585	0.371	negative regulation of response to stimulus
GO:0008284	0.369	positive regulation of cell population proliferation
GO:0051172	0.356	negative regulation of nitrogen compound metabolic process
GO:0070887	0.354	cellular response to chemical stimulus
GO:0048584	0.347	positive regulation of response to stimulus
GO:0071310	0.339	cellular response to organic substance
GO:0007166	0.317	cell surface receptor signaling pathway
GO:0048731	0.310	system development
GO:0048513	0.306	animal organ development
GO:0031324	0.303	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0032991	0.990	protein-containing complex
GO:0070013	0.934	intracellular organelle lumen
GO:0043231	0.883	intracellular membrane-bounded organelle
GO:0005737	0.827	cytoplasm
GO:0012505	0.767	endomembrane system
GO:0071944	0.465	cell periphery
GO:0005788	0.311	endoplasmic reticulum lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]