StarFunc result for job id P24723

User Input

>input (683 residues)
MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTK
QKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTTGASDTFEG
WVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYLR
QPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDSKIAEQRF
GINIPHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAV
ELAKTLAGMGLQPGNISPTSKLVSRSTLRRQGKESSKEGNGIGVNSSNRLGIDNFEFIRV
LGKGSFGKVMLARVKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLF
CCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKGIIYRDL
KLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAM
GVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSL
TQGGEHAILRHPFFKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDE
GHLPMINQDEFRNFSYVSPELQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B8A467	0.925	0.857	0.000	738	0.640	0.592	B8A467.pdb.gz	B8A467_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=prkceb PE=3 SV=1
2	AFDB:L7RTI5	0.656	0.614	0.000	737	0.653	0.605	L7RTI5.pdb.gz	L7RTI5_HUMAN Protein kinase C epsilon type OS=Homo sapiens OX=9606 GN=PRKCE PE=3 SV=1
3	AFDB:P23298	0.972	0.972	0.000	683	0.977	0.977	P23298.pdb.gz	KPCL_MOUSE Protein kinase C eta type OS=Mus musculus OX=10090 GN=Prkch PE=1 SV=2
4	AFDB:P13678	0.773	0.720	4.807E-94	739	0.559	0.517	P13678.pdb.gz	KPC3_DROME Protein kinase C OS=Drosophila melanogaster OX=7227 GN=Pkc98E PE=2 SV=2
5	AFDB:H9G2Y7	0.602	0.547	3.252E-93	763	0.567	0.507	H9G2Y7.pdb.gz	H9G2Y7_CAEEL Protein kinase C OS=Caenorhabditis elegans OX=6239 GN=pkc-1 PE=1 SV=1
6	AFDB:A0A024R328	0.513	0.519	8.030E-77	676	0.420	0.425	A0A024R328.pdb.gz
7	AFDB:P09215	0.495	0.502	2.129E-75	673	0.423	0.429	P09215.pdb.gz	KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus OX=10116 GN=Prkcd PE=1 SV=1
8	AFDB:Q02111	0.488	0.472	6.010E-75	707	0.417	0.403	Q02111.pdb.gz	KPCT_MOUSE Protein kinase C theta type OS=Mus musculus OX=10090 GN=Prkcq PE=1 SV=1
9	AFDB:F1R506	0.493	0.473	2.487E-74	713	0.442	0.424	F1R506.pdb.gz	F1R506_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=si:ch211-239o15.1 PE=3 SV=3
10	AFDB:Q7ZUC5	0.492	0.492	2.466E-73	684	0.419	0.418	Q7ZUC5.pdb.gz	Q7ZUC5_DANRE Protein kinase C delta type OS=Danio rerio OX=7955 GN=prkcd PE=1 SV=1
11	PDB:3pfqA	0.463	0.602	1.608E-43	523	0.324	0.423	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	PDB:6byrA	0.447	0.745	3.124E-31	405	0.196	0.331	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
13	PDB:5x3fB	0.392	0.749	2.096E-29	349	0.171	0.335	5x3fB.pdb.gz
14	PDB:3pvuA	0.416	0.464	4.504E-29	609	0.152	0.171	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
15	PDB:4yhjA	0.411	0.552	6.972E-29	501	0.174	0.238	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
16	PDB:3c4wB	0.405	0.529	1.271E-28	519	0.167	0.220	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
17	PDB:4mk0A	0.427	0.461	1.582E-28	631	0.149	0.162	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
18	PDB:6s9wA	0.378	0.611	1.968E-28	411	0.215	0.358	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
19	PDB:6pjxA	0.429	0.537	2.732E-28	543	0.170	0.214	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
20	PDB:3nynA	0.418	0.513	1.130E-27	554	0.164	0.202	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B8A467	0.0	919	738	0.643	0.595	B8A467_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=prkceb PE=3 SV=1
2	F1R506	0.0	573	713	0.442	0.424	F1R506_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=si:ch211-239o15.1 PE=3 SV=3
3	H9G2Y7	0.0	785	763	0.570	0.510	H9G2Y7_CAEEL Protein kinase C OS=Caenorhabditis elegans OX=6239 GN=pkc-1 PE=1 SV=1
4	L7RTI5	0.0	931	737	0.660	0.612	L7RTI5_HUMAN Protein kinase C epsilon type OS=Homo sapiens OX=9606 GN=PRKCE PE=3 SV=1
5	P09215	0.0	563	673	0.417	0.423	KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus OX=10116 GN=Prkcd PE=1 SV=1
6	P09216	0.0	924	737	0.654	0.607	KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus OX=10116 GN=Prkce PE=1 SV=1
7	P13678	0.0	766	739	0.565	0.522	KPC3_DROME Protein kinase C OS=Drosophila melanogaster OX=7227 GN=Pkc98E PE=2 SV=2
8	P16054	0.0	931	737	0.659	0.611	KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus OX=10090 GN=Prkce PE=1 SV=1
9	P23298	0.0	1411	683	0.977	0.977	KPCL_MOUSE Protein kinase C eta type OS=Mus musculus OX=10090 GN=Prkch PE=1 SV=2
10	P24723	0.0	1434	683	1.000	1.000	KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens OX=9606 GN=PRKCH PE=1 SV=4
11	P28867	0.0	564	674	0.416	0.421	KPCD_MOUSE Protein kinase C delta type OS=Mus musculus OX=10090 GN=Prkcd PE=1 SV=3
12	P34885	0.0	783	707	0.570	0.550	KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans OX=6239 GN=pkc-1 PE=1 SV=2
13	Q02111	0.0	546	707	0.416	0.402	KPCT_MOUSE Protein kinase C theta type OS=Mus musculus OX=10090 GN=Prkcq PE=1 SV=1
14	Q02156	0.0	931	737	0.660	0.612	KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens OX=9606 GN=PRKCE PE=1 SV=1
15	Q04759	0.0	544	706	0.420	0.407	KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens OX=9606 GN=PRKCQ PE=1 SV=3
16	Q05655	0.0	557	676	0.416	0.420	KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens OX=9606 GN=PRKCD PE=1 SV=2
17	Q64617	0.0	1409	683	0.974	0.974	KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus OX=10116 GN=Prkch PE=1 SV=1
18	Q7ZUC5	0.0	556	684	0.414	0.414	Q7ZUC5_DANRE Protein kinase C delta type OS=Danio rerio OX=7955 GN=prkcd PE=1 SV=1
19	Q9WTQ0	0.0	544	707	0.414	0.400	KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus OX=10116 GN=Prkcq PE=1 SV=2
20	P34722	7.36e-178	525	704	0.401	0.389	KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans OX=6239 GN=tpa-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	15	16.1	ABC1 atypical kinase-like domain
2	PF01636 APH	4.8e+02	12.0	Phosphotransferase enzyme family
3	PF00130 C1_1	9.3e-28	107.2	Phorbol esters/diacylglycerol binding domain (C1 domain)
4	PF03107 C1_2	3.5	19.3	C1 domain
5	PF00168 C2	2e-10	52.3	C2 domain
6	PF13095 FTA2	92	14.2	Kinetochore Sim4 complex subunit FTA2
7	PF14531 Kinase-like	0.029	25.3	Kinase-like
8	PF00069 Pkinase	2.4e-60	215.7	Protein kinase domain
9	PF00433 Pkinase_C	8.4e-07	40.9	Protein kinase C terminal domain
10	PF07714 PK_Tyr_Ser-Thr	1.9e-32	124.2	Protein tyrosine and serine/threonine kinase
11	PF16744 zf-RING_15	7.1e+02	11.7	KIAA1045 RING finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329127

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362680	0.935	Proto-oncogene tyrosine-protein kinase Src
2	9606.ENSP00000407586	0.932	GTPase HRas
3	9606.ENSP00000215832	0.930	Mitogen-activated protein kinase 1
4	9606.ENSP00000263025	0.929	Mitogen-activated protein kinase 3
5	9606.ENSP00000380638	0.914	Protein-tyrosine kinase 2-beta
6	9606.ENSP00000391669	0.902	Breast cancer anti-estrogen resistance protein 1
7	9606.ENSP00000381364	0.901	Calcineurin-binding protein cabin-1
8	9606.ENSP00000300574	0.900	Adapter molecule crk
9	9606.ENSP00000393333	0.900	Thromboxane A2 receptor
10	9606.ENSP00000406191	0.803	Transient receptor potential cation channel subfamily V member 4
11	9606.ENSP00000371594	0.773	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
12	9606.ENSP00000334448	0.744	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
13	9606.ENSP00000348632	0.732	RanBP-type and C3HC4-type zinc finger-containing protein 1
14	9606.ENSP00000386069	0.723	Alpha-2C adrenergic receptor
15	9606.ENSP00000261837	0.703	Guanine nucleotide-binding protein subunit beta-5
16	9606.ENSP00000481878	0.700	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
17	9606.ENSP00000229264	0.691	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
18	9606.ENSP00000232564	0.691	Guanine nucleotide-binding protein subunit beta-4
19	9606.ENSP00000305260	0.691	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
20	9606.ENSP00000248564	0.686	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004697	1.000	protein kinase C activity
GO:0019899	0.981	enzyme binding
GO:0019900	0.311	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0009987	0.991	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0050896	0.980	response to stimulus
GO:0048518	0.978	positive regulation of biological process
GO:0006796	0.965	phosphate-containing compound metabolic process
GO:0023052	0.959	signaling
GO:0007154	0.947	cell communication
GO:0016310	0.945	phosphorylation
GO:0051716	0.928	cellular response to stimulus
GO:0071704	0.924	organic substance metabolic process
GO:0006807	0.918	nitrogen compound metabolic process
GO:0043412	0.906	macromolecule modification
GO:0036211	0.901	protein modification process
GO:0048522	0.891	positive regulation of cellular process
GO:0007165	0.869	signal transduction
GO:0019222	0.835	regulation of metabolic process
GO:0048583	0.826	regulation of response to stimulus
GO:0006468	0.793	protein phosphorylation
GO:0051239	0.765	regulation of multicellular organismal process
GO:0060255	0.764	regulation of macromolecule metabolic process
GO:0010646	0.674	regulation of cell communication
GO:0023051	0.665	regulation of signaling
GO:0080090	0.632	regulation of primary metabolic process
GO:0031323	0.609	regulation of cellular metabolic process
GO:0048519	0.566	negative regulation of biological process
GO:0051171	0.550	regulation of nitrogen compound metabolic process
GO:0009966	0.506	regulation of signal transduction
GO:0010468	0.502	regulation of gene expression
GO:0048523	0.481	negative regulation of cellular process
GO:0032879	0.472	regulation of localization
GO:0048584	0.432	positive regulation of response to stimulus
GO:0050793	0.410	regulation of developmental process
GO:0009893	0.402	positive regulation of metabolic process
GO:0065009	0.392	regulation of molecular function
GO:0010604	0.370	positive regulation of macromolecule metabolic process
GO:0042221	0.367	response to chemical
GO:0031325	0.359	positive regulation of cellular metabolic process
GO:0032501	0.320	multicellular organismal process
GO:0042127	0.315	regulation of cell population proliferation
GO:0035556	0.314	intracellular signal transduction
GO:0051128	0.310	regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005829	0.998	cytosol
GO:0071944	0.975	cell periphery
GO:0005886	0.973	plasma membrane
GO:0043226	0.936	organelle
GO:0043227	0.809	membrane-bounded organelle
GO:0043229	0.702	intracellular organelle
GO:0043231	0.674	intracellular membrane-bounded organelle
GO:0070062	0.332	extracellular exosome
GO:0005634	0.313	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.13	1.000	protein kinase C.

[back to server]