StarFunc result for job id P24752

User Input

>input (427 residues)
MAVLAALLRSGARSRSPLLRRLVQEIRYVERSYVSKPTLKEVVIVSATRTPIGSFLGSLS
LLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCT
TINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIV
KDGLTDVYNKIHMGSCAENTAKKLNIARNEQDAYAINSYTRSKAAWEAGKFGNEVIPVTV
TVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADA
AKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMVLKDVGLKKEDIAMWEVNEAFSLVV
LANIKMLEIDPQKVNINGGAVSLGHPIGMSGARIVGHLTHALKQGEYGLASICNGGGGAS
AMLIQKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A5F9ZHL1	0.958	0.943	3.642E-88	434	0.993	0.977	A0A5F9ZHL1.pdb.gz	A0A5F9ZHL1_HUMAN Acetyl-CoA acetyltransferase 1 OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1
2	PDB:2ib8D	0.919	0.999	6.163E-86	393	0.920	1.000	2ib8D.pdb.gz	Crystallographic and Kinetic Studies of Human Mitochondrial Acetoacetyl-CoA Thiolase: The Importance of Potassium and Chloride Ions for Its Structure and Function
3	AFDB:P17764	0.934	0.941	4.427E-83	424	0.831	0.837	P17764.pdb.gz	THIL_RAT Acetyl-CoA acetyltransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acat1 PE=1 SV=1
4	AFDB:Q9W3N9	0.913	0.950	4.391E-69	410	0.614	0.639	Q9W3N9.pdb.gz	Q9W3N9_DROME LD24105p OS=Drosophila melanogaster OX=7227 GN=Acat1 PE=1 SV=1
5	AFDB:Q22100	0.905	0.950	7.383E-62	407	0.499	0.523	Q22100.pdb.gz	THILH_CAEEL Acetyl-CoA acetyltransferase homolog, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=kat-1 PE=1 SV=2
6	AFDB:Q8S4Y1	0.895	0.948	1.503E-57	403	0.475	0.504	Q8S4Y1.pdb.gz	ACCT2_ARATH Acetyl-CoA acetyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=ACCT2 PE=1 SV=1
7	AFDB:A0A5F9ZI66	0.693	0.919	1.700E-57	322	0.665	0.882	A0A5F9ZI66.pdb.gz	A0A5F9ZI66_HUMAN Acetyl-CoA acetyltransferase 1 OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1
8	AFDB:Q86AD9	0.891	0.919	1.015E-56	414	0.482	0.498	Q86AD9.pdb.gz	THIL1_DICDI Probable acetyl-CoA acetyltransferase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271544 PE=2 SV=1
9	AFDB:P41338	0.895	0.959	2.721E-56	398	0.450	0.482	P41338.pdb.gz	ERG10_YEAST Acetyl-CoA acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERG10 PE=1 SV=3
10	AFDB:Q9FIK7	0.894	0.919	3.273E-56	415	0.475	0.489	Q9FIK7.pdb.gz	AACT1_ARATH Acetyl-CoA acetyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=ACCT1 PE=1 SV=1
11	AFDB:Q9UQW6	0.891	0.963	1.838E-55	395	0.461	0.499	Q9UQW6.pdb.gz	ERG10_SCHPO Acetyl-CoA acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=erg10 PE=2 SV=1
12	PDB:5xyjA	0.893	0.963	9.274E-55	396	0.447	0.482	5xyjA.pdb.gz
13	PDB:4wysA	0.890	0.959	1.509E-51	396	0.419	0.452	4wysA.pdb.gz
14	PDB:1wl4A	0.885	0.958	2.415E-50	394	0.398	0.431	1wl4A.pdb.gz	High Resolution Crystal Structures of Human Cytosolic Thiolase (CT): A Comparison of the Active Sites of Human CT, Bacterial Thiolase, and Bacterial KAS I
15	PDB:5f38A	0.831	0.955	1.864E-44	371	0.407	0.469	5f38A.pdb.gz	Crystal structure of a thiolase from Escherichia coli at 1.8 angstrom resolution.
16	PDB:4c2kD	0.873	0.933	8.702E-44	399	0.372	0.398	4c2kD.pdb.gz
17	PDB:2wu9A	0.814	0.861	2.900E-39	403	0.290	0.308	2wu9A.pdb.gz
18	PDB:4ubtA	0.815	0.876	1.842E-38	396	0.302	0.326	4ubtA.pdb.gz	FadA5 a Thiolase from Mycobacterium tuberculosis: A Steroid-Binding Pocket Reveals the Potential for Drug Development against Tuberculosis.
19	PDB:6dv2A	0.816	0.807	4.936E-38	432	0.304	0.301	6dv2A.pdb.gz
20	PDB:1afwB	0.788	0.854	2.304E-37	393	0.309	0.336	1afwB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VJX1	0.0	870	427	1.000	1.000	A0A140VJX1_HUMAN Testicular tissue protein Li 198 OS=Homo sapiens OX=9606 PE=2 SV=1
2	A0A5F9ZHD4	0.0	583	306	0.663	0.925	A0A5F9ZHD4_HUMAN Acetyl-CoA acetyltransferase 1 OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1
3	A0A5F9ZHJ0	0.0	694	337	0.789	1.000	A0A5F9ZHJ0_HUMAN Acetyl-CoA acetyltransferase 1 OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1
4	A0A5F9ZHL1	0.0	863	434	1.000	0.984	A0A5F9ZHL1_HUMAN Acetyl-CoA acetyltransferase 1 OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1
5	A0A5F9ZI66	0.0	582	322	0.660	0.876	A0A5F9ZI66_HUMAN Acetyl-CoA acetyltransferase 1 OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1
6	P17764	0.0	721	424	0.831	0.837	THIL_RAT Acetyl-CoA acetyltransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acat1 PE=1 SV=1
7	P24752	0.0	870	427	1.000	1.000	THIL_HUMAN Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1
8	Q8QZT1	0.0	724	424	0.836	0.842	THIL_MOUSE Acetyl-CoA acetyltransferase, mitochondrial OS=Mus musculus OX=10090 GN=Acat1 PE=1 SV=1
9	Q9W3N9	0.0	548	410	0.623	0.649	Q9W3N9_DROME LD24105p OS=Drosophila melanogaster OX=7227 GN=Acat1 PE=1 SV=1
10	Q22100	1.40e-156	450	407	0.499	0.523	THILH_CAEEL Acetyl-CoA acetyltransferase homolog, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=kat-1 PE=1 SV=2
11	Q86AD9	4.32e-135	395	414	0.482	0.498	THIL1_DICDI Probable acetyl-CoA acetyltransferase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271544 PE=2 SV=1
12	Q9UQW6	4.89e-133	390	395	0.466	0.504	ERG10_SCHPO Acetyl-CoA acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=erg10 PE=2 SV=1
13	Q9FIK7	5.29e-128	377	415	0.471	0.484	AACT1_ARATH Acetyl-CoA acetyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=ACCT1 PE=1 SV=1
14	Q8S4Y1	8.52e-122	361	403	0.475	0.504	ACCT2_ARATH Acetyl-CoA acetyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=ACCT2 PE=1 SV=1
15	P41338	3.24e-121	360	398	0.452	0.485	ERG10_YEAST Acetyl-CoA acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERG10 PE=1 SV=3
16	Q46939	9.65e-108	325	393	0.407	0.443	YQEF_ECOLI Probable acetyl-CoA acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=yqeF PE=3 SV=2
17	Q80X81	7.89e-102	310	397	0.400	0.431	Q80X81_MOUSE Acetyl-Coenzyme A acetyltransferase 3 OS=Mus musculus OX=10090 GN=Acat3 PE=1 SV=1
18	Q8R4V3	2.14e-100	306	397	0.396	0.426	Q8R4V3_MOUSE Acetyl CoA transferase-like protein OS=Mus musculus OX=10090 GN=Acat3 PE=2 SV=1
19	Q8CAY6	3.73e-99	303	397	0.405	0.436	THIC_MOUSE Acetyl-CoA acetyltransferase, cytosolic OS=Mus musculus OX=10090 GN=Acat2 PE=1 SV=2
20	Q9BWD1	1.25e-98	302	397	0.398	0.428	THIC_HUMAN Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=ACAT2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00109 ketoacyl-synt	0.0062	27.7	Beta-ketoacyl synthase, N-terminal domain
2	PF02803 Thiolase_C	8.4e-43	156.4	Thiolase, C-terminal domain
3	PF00108 Thiolase_N	1.8e-93	324.2	Thiolase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265838

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370023	0.986	Trifunctional enzyme subunit alpha, mitochondrial
2	9606.ENSP00000358414	0.984	Hydroxymethylglutaryl-CoA synthase, mitochondrial
3	9606.ENSP00000322706	0.982	Hydroxymethylglutaryl-CoA synthase, cytoplasmic
4	9606.ENSP00000196371	0.976	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial
5	9606.ENSP00000242592	0.976	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
6	9606.ENSP00000285093	0.973	3-ketoacyl-CoA thiolase, mitochondrial
7	9606.ENSP00000280346	0.970	Dihydrolipoamide S-acetyltransferase
8	9606.ENSP00000357873	0.969	Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial
9	9606.ENSP00000231887	0.968	Peroxisomal bifunctional enzyme
10	9606.ENSP00000361914	0.967	Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial
11	9606.ENSP00000363614	0.963	Hydroxymethylglutaryl-CoA lyase, mitochondrial
12	9606.ENSP00000342056	0.956	Citrate synthase, mitochondrial
13	9606.ENSP00000348775	0.953	Peroxisomal acyl-coenzyme A oxidase 3
14	9606.ENSP00000324842	0.950	Acetoacetyl-CoA synthetase
15	9606.ENSP00000293217	0.947	Peroxisomal acyl-coenzyme A oxidase 1
16	9606.ENSP00000253382	0.944	Acetyl-coenzyme A synthetase, cytoplasmic
17	9606.ENSP00000316924	0.941	Acetyl-coenzyme A synthetase 2-like, mitochondrial
18	9606.ENSP00000381654	0.941	3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic
19	9606.ENSP00000325136	0.938	hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
20	9606.ENSP00000333664	0.938	3-ketoacyl-CoA thiolase, peroxisomal

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003988	0.999	acetyl-CoA C-acyltransferase activity
GO:0016453	0.999	C-acetyltransferase activity
GO:0005488	0.998	binding
GO:0005515	0.984	protein binding
GO:0003985	0.980	acetyl-CoA C-acetyltransferase activity
GO:0043167	0.756	ion binding
GO:0097159	0.679	organic cyclic compound binding
GO:1901363	0.676	heterocyclic compound binding
GO:0016491	0.315	oxidoreductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0044281	0.981	small molecule metabolic process
GO:0006629	0.951	lipid metabolic process
GO:0033865	0.942	nucleoside bisphosphate metabolic process
GO:0035383	0.919	thioester metabolic process
GO:0033875	0.919	ribonucleoside bisphosphate metabolic process
GO:0034032	0.919	purine nucleoside bisphosphate metabolic process
GO:0019693	0.897	ribose phosphate metabolic process
GO:0006637	0.872	acyl-CoA metabolic process
GO:0044282	0.768	small molecule catabolic process
GO:1901575	0.767	organic substance catabolic process
GO:0044248	0.752	cellular catabolic process
GO:0019752	0.730	carboxylic acid metabolic process
GO:1901576	0.555	organic substance biosynthetic process
GO:0046395	0.528	carboxylic acid catabolic process
GO:0044249	0.418	cellular biosynthetic process
GO:0016042	0.414	lipid catabolic process
GO:0008610	0.357	lipid biosynthetic process
GO:0032787	0.351	monocarboxylic acid metabolic process
GO:0044255	0.316	cellular lipid metabolic process
GO:0006631	0.313	fatty acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.949	intracellular organelle lumen
GO:0005759	0.491	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21564	0.999	acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA
EC:2.3.1.16	0.999	acetyl-CoA C-acyltransferase.
RHEA:21036	0.980	2 acetyl-CoA = acetoacetyl-CoA + CoA
EC:2.3.1.9	0.980	acetyl-CoA C-acetyltransferase.
EC:1.-.-.-	0.315	Oxidoreductases.

[back to server]