StarFunc result for job id P24821

User Input

>input (2201 residues)
MGAMTQLLAGVFLAFLALATEGGVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPV
GSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVK
ELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGW
KGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFE
GYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECV
CDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKPTCPHACHTQGRCEEGQ
CVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVN
GQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRC
VNGMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGPDCAELSCPNDCHGQG
RCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNN
LGQCVSGRCICNEGYSGEDCSEVSPPKDLVVTEVTEETVNLAWDNEMRVTEYLVVYTPTH
EGGLEMQFRVPGDQTSTIIQELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKF
KSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYE
ISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIK
DVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLR
RVSQTDNSITLEWRNGKAAIDSYRIKYAPISGGDHAEVDVPKSQQATTKTTLTGLRPGTE
YGIGVSAVKEDKESNPATINAATELDTPKDLQVSETAETSLTLLWKTPLAKFDRYRLNYS
LPTGQWVGVQLPRNTTSYVLRGLEPGQEYNVLLTAEKGRHKSKPARVKASTEQAPELENL
TVTEVGWDGLRLNWTAADQAYEHFIIQVQEANKVEAARNLTVPGSLRAVDIPGLKAATPY
TVSIYGVIQGYRTPVLSAEASTGETPNLGEVVVAEVGWDALKLNWTAPEGAYEYFFIQVQ
EADTVEAAQNLTVPGGLRSTDLPGLKAATHYTITIRGVTQDFSTTPLSVEVLTEEVPDMG
NLTVTEVSWDALRLNWTTPDGTYDQFTIQVQEADQVEEAHNLTVPGSLRSMEIPGLRAGT
PYTVTLHGEVRGHSTRPLAVEVVTEDLPQLGDLAVSEVGWDGLRLNWTAADNAYEHFVIQ
VQEVNKVEAAQNLTLPGSLRAVDIPGLEAATPYRVSIYGVIRGYRTPVLSAEASTAKEPE
IGNLNVSDITPESFNLSWMATDGIFETFTIEIIDSNRLLETVEYNISGAERTAHISGLPP
STDFIVYLSGLAPSIRTKTISATATTEALPLLENLTISDINPYGFTVSWMASENAFDSFL
VTVVDSGKLLDPQEFTLSGTQRKLELRGLITGIGYEVMVSGFTQGHQTKPLRAEIVTEAE
PEVDNLLVSDATPDGFRLSWTADEGVFDNFVLKIRDTKKQSEPLEITLLAPERTRDITGL
REATEYEIELYGISKGRRSQTVSAIATTAMGSPKEVIFSDITENSATVSWRAPTAQVESF
RITYVPITGGTPSMVTVDGTKTQTRLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALD
GPSGLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPA
TEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEVQSETALLTWRPPRASVTGYLLV
YESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPF
PKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNW
KAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYK
LKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGD
NNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K1L0	0.262	0.281	0.000	2019	0.800	0.872	A0A0G2K1L0.pdb.gz	A0A0G2K1L0_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=2
2	AFDB:F1QYE2	0.206	0.246	0.000	1811	0.453	0.551	F1QYE2.pdb.gz	F1QYE2_DANRE Tenascin C OS=Danio rerio OX=7955 GN=tenc PE=1 SV=1
3	AFDB:P24821	1.000	1.000	0.000	2201	1.000	1.000	P24821.pdb.gz	TENA_HUMAN Tenascin OS=Homo sapiens OX=9606 GN=TNC PE=1 SV=3
4	AFDB:Q29116	0.193	0.238	0.000	1746	0.703	0.886	Q29116.pdb.gz	TENA_PIG Tenascin OS=Sus scrofa OX=9823 GN=TNC PE=1 SV=1
5	AFDB:Q80Z71	0.162	0.210	0.000	1560	0.214	0.301	Q80Z71.pdb.gz	TENN_MOUSE Tenascin-N OS=Mus musculus OX=10090 GN=Tnn PE=1 SV=2
6	AFDB:Q8BYI9	0.151	0.233	0.000	1358	0.279	0.451	Q8BYI9.pdb.gz	TENR_MOUSE Tenascin-R OS=Mus musculus OX=10090 GN=Tnr PE=1 SV=2
7	AFDB:Q9UQP3	0.184	0.274	1.648E-95	1299	0.186	0.316	Q9UQP3.pdb.gz	TENN_HUMAN Tenascin-N OS=Homo sapiens OX=9606 GN=TNN PE=1 SV=2
8	AFDB:P07589	0.168	0.156	7.589E-90	2478	0.147	0.130	P07589.pdb.gz	FINC_BOVIN Fibronectin OS=Bos taurus OX=9913 GN=FN1 PE=1 SV=4
9	AFDB:P23467	0.155	0.168	1.066E-73	1997	0.117	0.129	P23467.pdb.gz	PTPRB_HUMAN Receptor-type tyrosine-protein phosphatase beta OS=Homo sapiens OX=9606 GN=PTPRB PE=1 SV=3
10	AFDB:Q62308	0.112	0.261	1.585E-73	860	0.144	0.369	Q62308.pdb.gz	Q62308_MOUSE Tenascin-X (Fragment) OS=Mus musculus OX=10090 GN=Tnxb PE=2 SV=1
11	PDB:1jc9A	0.094	0.910	1.086E-20	220	0.042	0.423	1jc9A.pdb.gz	The 2.0-A crystal structure of tachylectin 5A provides evidence for the common origin of the innate immunity and the blood coagulation systems.
12	PDB:1m1jB	0.091	0.484	5.526E-16	402	0.033	0.182	1m1jB.pdb.gz	Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
13	PDB:5a42A	0.058	0.074	1.221E-15	1597	0.058	0.080	5a42A.pdb.gz
14	PDB:3ghgB	0.092	0.490	1.457E-15	401	0.035	0.195	3ghgB.pdb.gz	Crystal structure of human fibrinogen.
15	PDB:1ei3C	0.095	0.506	7.114E-15	397	0.036	0.202	1ei3C.pdb.gz
16	PDB:3ghgI	0.096	0.511	2.788E-14	394	0.037	0.206	3ghgI.pdb.gz	Crystal structure of human fibrinogen.
17	PDB:7q1yA	0.066	0.098	1.141E-13	1374	0.059	0.095	7q1yA.pdb.gz
18	PDB:6h03A	0.066	0.103	3.009E-13	1223	0.034	0.061	6h03A.pdb.gz
19	PDB:7q5zA	0.060	0.084	6.088E-13	1344	0.055	0.091	7q5zA.pdb.gz
20	PDB:5oj2B	0.090	0.204	8.661E-13	692	0.044	0.139	5oj2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K1L0	1893	2110	0.446	0.465	A0A0G2K1L0_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=2
2	A0A571BG59	772	4114	0.238	0.127	A0A571BG59_MOUSE Tenascin XB OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1
3	A0A5F8MPH8	769	4356	0.238	0.120	A0A5F8MPH8_MOUSE Tenascin XB OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1
4	A0A8I6AG89	1506	2019	0.359	0.392	A0A8I6AG89_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
5	A0A8I6AIS3	1009	1564	0.252	0.355	A0A8I6AIS3_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
6	A0A8I6ARC1	3766	2202	0.821	0.821	A0A8I6ARC1_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
7	A0A8I6GHT4	1431	1928	0.344	0.393	A0A8I6GHT4_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
8	A1L306	594	1257	0.163	0.285	A1L306_HUMAN TNR protein OS=Homo sapiens OX=9606 GN=TNR PE=1 SV=1
9	A5A8W4	732	4137	0.234	0.124	A5A8W4_PIG Tenascin XB OS=Sus scrofa OX=9823 GN=TNXB PE=3 SV=1
10	B2LYI9	1494	2019	0.355	0.387	B2LYI9_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=2 SV=1
11	E9Q2T3	775	3126	0.239	0.169	E9Q2T3_MOUSE Tenascin XB OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1
12	E9QHI1	1376	1720	0.317	0.406	E9QHI1_DANRE Tenascin C OS=Danio rerio OX=7955 GN=tenc PE=1 SV=1
13	F1QYE2	1414	1811	0.326	0.396	F1QYE2_DANRE Tenascin C OS=Danio rerio OX=7955 GN=tenc PE=1 SV=1
14	H1A489	602	1356	0.157	0.255	H1A489_TAEGU Tenascin R OS=Taeniopygia guttata OX=59729 GN=TNR PE=3 SV=2
15	O18977	709	4135	0.209	0.111	O18977_BOVIN Tenascin-X OS=Bos taurus OX=9913 GN=TN-X PE=2 SV=1
16	O35452	771	4006	0.238	0.131	O35452_MOUSE Tenascin X OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1
17	O54796	771	4114	0.238	0.127	O54796_MOUSE Tenascin-X OS=Mus musculus OX=10090 GN=Tnx PE=3 SV=1
18	P22105	784	4244	0.244	0.126	TENX_HUMAN Tenascin-X OS=Homo sapiens OX=9606 GN=TNXB PE=1 SV=5
19	P24821	4551	2201	1.000	1.000	TENA_HUMAN Tenascin OS=Homo sapiens OX=9606 GN=TNC PE=1 SV=3
20	Q05546	627	1356	0.156	0.253	TENR_RAT Tenascin-R OS=Rattus norvegicus OX=10116 GN=Tnr PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16389 DUF4998	0.00057	31.0	Domain of unknown function
2	PF00008 EGF	2.1e-14	64.8	EGF-like domain
3	PF07974 EGF_2	5.6e-58	204.3	EGF-like domain
4	PF18720 EGF_Tenascin	1.9e-58	205.0	Tenascin EGF domain
5	PF00147 Fibrinogen_C	1.5e-86	301.3	Fibrinogen beta and gamma chains, C-terminal globular domain
6	PF00041 fn3	9.2e-197	649.4	Fibronectin type III domain
7	PF16893 fn3_2	0.00052	31.4	Fibronectin type III domain
8	PF12661 hEGF	4e-05	35.3	Human growth factor-like EGF
9	PF09294 Interfer-bind	0.00012	33.7	Interferon-alpha/beta receptor, fibronectin type III
10	PF10179 NDNF	4.3e-05	35.0	Neuron-derived neurotrophic factor, first Fn(III) domain
11	PF15411 PH_10	70	15.1	Pleckstrin homology domain
12	PF10604 Polyketide_cyc2	50	15.6	Polyketide cyclase / dehydrase and lipid transport
13	PF16656 Pur_ac_phosph_N	6.4e-10	50.9	Purple acid Phosphatase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265131

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387356	0.949	Aggrecan core protein
2	9606.ENSP00000261023	0.924	Integrin alpha-V
3	9606.ENSP00000452120	0.924	Integrin alpha-7
4	9606.ENSP00000264741	0.923	Integrin alpha-9
5	9606.ENSP00000361818	0.923	Syndecan-4
6	9606.ENSP00000296585	0.921	Integrin alpha-2
7	9606.ENSP00000367316	0.920	Integrin alpha-8
8	9606.ENSP00000379350	0.909	Integrin beta-1
9	9606.ENSP00000452786	0.909	Integrin beta-3
10	9606.ENSP00000362680	0.908	Proto-oncogene tyrosine-protein kinase Src
11	9606.ENSP00000267257	0.905	Paxillin
12	9606.ENSP00000368572	0.901	Diamine acetyltransferase 1
13	9606.ENSP00000370542	0.832	Syndecan-1
14	9606.ENSP00000252575	0.820	Neurocan core protein
15	9606.ENSP00000283249	0.812	Integrin beta-6
16	9606.ENSP00000265077	0.780	Versican core protein
17	9606.ENSP00000293379	0.747	Integrin alpha-5
18	9606.ENSP00000386896	0.714	Integrin alpha-6
19	9606.ENSP00000341189	0.707	Focal adhesion kinase 1
20	9606.ENSP00000007722	0.698	Integrin alpha-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043394	1.000	proteoglycan binding
GO:0044877	0.799	protein-containing complex binding
GO:0045545	0.778	syndecan binding
GO:0005102	0.746	signaling receptor binding
GO:0042802	0.545	identical protein binding
GO:0005518	0.358	collagen binding
GO:0005539	0.354	glycosaminoglycan binding
GO:0008201	0.339	heparin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0009653	0.987	anatomical structure morphogenesis
GO:0007275	0.986	multicellular organism development
GO:0051716	0.985	cellular response to stimulus
GO:0009888	0.984	tissue development
GO:0030182	0.979	neuron differentiation
GO:0048513	0.978	animal organ development
GO:0030030	0.977	cell projection organization
GO:0048468	0.975	cell development
GO:0071295	0.973	cellular response to vitamin
GO:1901654	0.968	response to ketone
GO:0030324	0.965	lung development
GO:0048519	0.964	negative regulation of biological process
GO:0042476	0.955	odontogenesis
GO:0007162	0.953	negative regulation of cell adhesion
GO:0033280	0.950	response to vitamin D
GO:0001763	0.949	morphogenesis of a branching structure
GO:0032526	0.949	response to retinoic acid
GO:0060425	0.949	lung morphogenesis
GO:0034694	0.946	response to prostaglandin
GO:0042060	0.937	wound healing
GO:0003401	0.935	axis elongation
GO:1901655	0.934	cellular response to ketone
GO:0031175	0.924	neuron projection development
GO:0042475	0.921	odontogenesis of dentin-containing tooth
GO:0035239	0.913	tube morphogenesis
GO:0071300	0.913	cellular response to retinoic acid
GO:0009612	0.895	response to mechanical stimulus
GO:0071774	0.890	response to fibroblast growth factor
GO:0048754	0.887	branching morphogenesis of an epithelial tube
GO:0097305	0.847	response to alcohol
GO:0097306	0.810	cellular response to alcohol
GO:0007155	0.752	cell adhesion
GO:0071495	0.708	cellular response to endogenous stimulus
GO:0045471	0.697	response to ethanol
GO:0032870	0.616	cellular response to hormone stimulus
GO:0071407	0.602	cellular response to organic cyclic compound
GO:0048518	0.469	positive regulation of biological process
GO:0048522	0.393	positive regulation of cellular process
GO:0023052	0.335	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.995	cell periphery
GO:0031012	0.994	extracellular matrix
GO:0062023	0.797	collagen-containing extracellular matrix
GO:0043226	0.741	organelle
GO:0005622	0.705	intracellular anatomical structure
GO:0043229	0.629	intracellular organelle
GO:0043227	0.575	membrane-bounded organelle
GO:0005886	0.530	plasma membrane
GO:0043231	0.489	intracellular membrane-bounded organelle
GO:0005576	0.422	extracellular region
GO:0005788	0.399	endoplasmic reticulum lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]