StarFunc result for job id P24844

User Input

>input (172 residues)
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JSW0	0.689	0.689	2.205E-26	172	0.930	0.930	A0A0G2JSW0.pdb.gz	A0A0G2JSW0_RAT Myosin light chain 12A OS=Rattus norvegicus OX=10116 GN=Myl12b PE=4 SV=2
2	AFDB:P40423	0.742	0.735	7.235E-24	174	0.808	0.799	P40423.pdb.gz	SQH_DROME Myosin regulatory light chain sqh OS=Drosophila melanogaster OX=7227 GN=sqh PE=1 SV=1
3	AFDB:Q09510	0.814	0.814	9.870E-22	172	0.703	0.703	Q09510.pdb.gz	MLRH_CAEEL Myosin regulatory light chain OS=Caenorhabditis elegans OX=6239 GN=mlc-4 PE=1 SV=1
4	PDB:7mf3D	0.601	0.640	6.164E-20	158	0.913	0.994	7mf3D.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
5	AFDB:Q62082	0.612	0.539	9.650E-18	202	0.541	0.460	Q62082.pdb.gz	MYL10_MOUSE Myosin regulatory light chain 10 OS=Mus musculus OX=10090 GN=Myl10 PE=2 SV=1
6	AFDB:P04466	0.629	0.637	1.733E-17	169	0.529	0.538	P04466.pdb.gz	MYL11_RAT Myosin regulatory light chain 11 OS=Rattus norvegicus OX=10116 GN=Myl11 PE=1 SV=2
7	AFDB:Q7T2Y1	0.629	0.629	2.190E-17	172	0.552	0.552	Q7T2Y1.pdb.gz
8	AFDB:P08733	0.730	0.752	4.168E-17	166	0.529	0.548	P08733.pdb.gz	MLRV_RAT Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Rattus norvegicus OX=10116 GN=Myl2 PE=1 SV=2
9	AFDB:Q02045	0.671	0.668	1.003E-16	173	0.523	0.520	Q02045.pdb.gz	MYL5_HUMAN Myosin light chain 5 OS=Homo sapiens OX=9606 GN=MYL5 PE=2 SV=1
10	AFDB:A7XZM2	0.575	0.583	2.412E-16	170	0.523	0.529	A7XZM2.pdb.gz	A7XZM2_ONCMY Fast myosin light chain 2 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
11	AFDB:A0A060WU79	0.752	0.657	2.557E-16	200	0.477	0.410	A0A060WU79.pdb.gz	A0A060WU79_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039796001 PE=4 SV=1
12	PDB:7qioP	0.485	0.552	1.417E-11	143	0.477	0.573	7qioP.pdb.gz
13	PDB:5tbyE	0.588	0.622	1.099E-10	160	0.500	0.537	5tbyE.pdb.gz
14	PDB:1i84U	0.548	0.647	4.477E-10	138	0.407	0.507	1i84U.pdb.gz
15	PDB:3wfnB	0.362	0.368	7.150E-10	169	0.355	0.361	3wfnB.pdb.gz
16	PDB:5a2hA	0.401	0.459	3.274E-9	147	0.343	0.401	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
17	PDB:1osaA	0.373	0.429	5.229E-9	148	0.337	0.392	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
18	PDB:1ggzA	0.440	0.510	6.609E-9	144	0.355	0.424	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
19	PDB:2f2pA	0.356	0.360	1.334E-8	169	0.366	0.373	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
20	PDB:6xu4A	0.379	0.174	1.499E-8	389	0.326	0.144	6xu4A.pdb.gz	FGCaMP7, an Improved Version of Fungi-Based Ratiometric Calcium Indicator for In Vivo Visualization of Neuronal Activity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P24844	3.82e-127	355	172	1.000	1.000	MYL9_HUMAN Myosin regulatory light polypeptide 9 OS=Homo sapiens OX=9606 GN=MYL9 PE=1 SV=4
2	P02612	9.39e-127	354	172	0.994	0.994	MLRM_CHICK Myosin regulatory light chain 2, smooth muscle major isoform OS=Gallus gallus OX=9031 PE=1 SV=2
3	Q9CQ19	2.55e-126	353	172	0.994	0.994	MYL9_MOUSE Myosin regulatory light polypeptide 9 OS=Mus musculus OX=10090 GN=Myl9 PE=1 SV=3
4	Q5E9E2	5.08e-115	325	172	0.942	0.942	MYL9_BOVIN Myosin regulatory light polypeptide 9 OS=Bos taurus OX=9913 GN=MYL9 PE=2 SV=3
5	A0A8I6AWG5	2.30e-114	325	208	0.936	0.774	A0A8I6AWG5_RAT Myosin light chain 12A OS=Rattus norvegicus OX=10116 GN=Myl12a PE=4 SV=1
6	A0A8I5ZNJ5	3.11e-114	323	178	0.936	0.904	A0A8I5ZNJ5_RAT Myosin light chain 12A OS=Rattus norvegicus OX=10116 GN=Myl12a PE=4 SV=1
7	Q6ZWQ9	4.61e-114	322	172	0.936	0.936	Q6ZWQ9_MOUSE Myosin, light chain 12A, regulatory, non-sarcomeric OS=Mus musculus OX=10090 GN=Myl12a PE=1 SV=1
8	A0A0G2JSW0	7.23e-114	322	172	0.930	0.930	A0A0G2JSW0_RAT Myosin light chain 12A OS=Rattus norvegicus OX=10116 GN=Myl12b PE=4 SV=2
9	O14950	1.10e-111	317	172	0.930	0.930	ML12B_HUMAN Myosin regulatory light chain 12B OS=Homo sapiens OX=9606 GN=MYL12B PE=1 SV=2
10	Q3THE2	1.10e-111	317	172	0.930	0.930	ML12B_MOUSE Myosin regulatory light chain 12B OS=Mus musculus OX=10090 GN=Myl12b PE=1 SV=2
11	P19105	1.94e-110	313	171	0.866	0.871	ML12A_HUMAN Myosin regulatory light chain 12A OS=Homo sapiens OX=9606 GN=MYL12A PE=1 SV=2
12	P18666	3.30e-110	313	172	0.924	0.924	ML12B_RAT Myosin regulatory light chain 12B OS=Rattus norvegicus OX=10116 GN=Myl12b PE=1 SV=3
13	A0A8L2UJI1	4.41e-110	312	169	0.924	0.941	A0A8L2UJI1_RAT Myosin light chain 12A OS=Rattus norvegicus OX=10116 GN=Myl12a PE=4 SV=1
14	Q53HL1	6.15e-110	312	171	0.860	0.865	Q53HL1_HUMAN Myosin regulatory light chain MRCL3 variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
15	A0A8I5ZXA1	2.25e-108	309	208	0.895	0.740	A0A8I5ZXA1_RAT Myosin light chain 12A OS=Rattus norvegicus OX=10116 GN=Myl12a PE=4 SV=1
16	P40423	2.17e-100	288	174	0.814	0.805	SQH_DROME Myosin regulatory light chain sqh OS=Drosophila melanogaster OX=7227 GN=sqh PE=1 SV=1
17	Q09510	1.32e-87	256	172	0.715	0.715	MLRH_CAEEL Myosin regulatory light chain OS=Caenorhabditis elegans OX=6239 GN=mlc-4 PE=1 SV=1
18	D3YV37	1.08e-66	200	107	0.593	0.953	D3YV37_MOUSE Myosin, light chain 12A, regulatory, non-sarcomeric (Fragment) OS=Mus musculus OX=10090 GN=Myl12a PE=1 SV=1
19	Q801M3	6.83e-63	193	172	0.558	0.558	Q801M3_DANRE Myosin light chain 2 Mlc2a OS=Danio rerio OX=7955 GN=cmlc2 PE=1 SV=1
20	Q62082	4.36e-61	189	202	0.541	0.460	MYL10_MOUSE Myosin regulatory light chain 10 OS=Mus musculus OX=10090 GN=Myl10 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10025 DUF2267	2.6e+02	13.3	Uncharacterized conserved protein (DUF2267)
2	PF12552 DUF3741	1.7e+02	13.5	Protein of unknown function (DUF3741)
3	PF00036 EF-hand_1	7e-13	58.2	EF hand
4	PF08976 EF-hand_11	0.41	22.9	EF-hand domain
5	PF13202 EF-hand_5	0.034	24.8	EF hand
6	PF13405 EF-hand_6	1e-08	45.3	EF-hand domain
7	PF13499 EF-hand_7	1e-10	53.2	EF-hand domain pair
8	PF13833 EF-hand_8	0.00039	31.4	EF-hand domain pair
9	PF14658 EF-hand_9	4.5	19.1	EF-hand domain
10	PF16905 GPHH	12	17.3	Voltage-dependent L-type calcium channel, IQ-associated
11	PF10591 SPARC_Ca_bdg	2e+02	13.7	Secreted protein acidic and rich in cysteine Ca binding region
12	PF03672 UPF0154	26	16.2	Uncharacterised protein family (UPF0154)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008849393.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008828101.1	0.991	Myosin heavy chain 11
2	1026970.XP_008853014.1	0.987	Myosin heavy chain 9
3	1026970.XP_008854185.1	0.986	Myosin-10
4	1026970.XP_008841180.1	0.964	Myosin light chain kinase, smooth muscle isoform X1
5	1026970.XP_008843351.1	0.959	Myosin-14 isoform X1
6	1026970.XP_008846927.1	0.958	Myosin light chain 6
7	1026970.XP_008846925.1	0.948	Myosin light chain 6B
8	1026970.XP_008850325.1	0.948	Protein phosphatase 1 regulatory subunit 12A
9	1026970.XP_008848327.1	0.946	Rho associated coiled-coil containing protein kinase 2
10	1026970.XP_008832839.1	0.932	Myosin regulatory light polypeptide 9 isoform X1
11	1026970.XP_008832841.1	0.932	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 1 EST, 45 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns
12	1026970.XP_008826632.1	0.924	Protein phosphatase 1 catalytic subunit beta
13	1026970.XP_008827611.1	0.903	Myosin light chain kinase 2, skeletal/cardiac muscle
14	1026970.XP_008825185.1	0.885	Rho associated coiled-coil containing protein kinase 1
15	1026970.XP_008821105.1	0.884	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
16	1026970.XP_008837623.1	0.884	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit isoform X1
17	1026970.XP_008826829.1	0.883	Actin gamma 1
18	1026970.XP_008849594.1	0.883	Actin beta
19	1026970.XP_008844899.1	0.874	Protein phosphatase 1 regulatory subunit 12C
20	1026970.XP_008836064.1	0.855	Actin, alpha 2, smooth muscle, aorta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.945	cytoskeletal protein binding
GO:0017022	0.778	myosin binding
GO:0032036	0.648	myosin heavy chain binding
GO:0005198	0.563	structural molecule activity
GO:0008307	0.449	structural constituent of muscle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0065007	0.989	biological regulation
GO:0050789	0.973	regulation of biological process
GO:0032501	0.965	multicellular organismal process
GO:0050896	0.959	response to stimulus
GO:0030029	0.958	actin filament-based process
GO:0016043	0.918	cellular component organization
GO:0032502	0.901	developmental process
GO:0009611	0.894	response to wounding
GO:0048856	0.890	anatomical structure development
GO:0007010	0.877	cytoskeleton organization
GO:0050817	0.852	coagulation
GO:0031032	0.829	actomyosin structure organization
GO:0030168	0.825	platelet activation
GO:0034109	0.815	homotypic cell-cell adhesion
GO:0050794	0.814	regulation of cellular process
GO:0070527	0.813	platelet aggregation
GO:0022604	0.787	regulation of cell morphogenesis
GO:0008360	0.736	regulation of cell shape
GO:0009653	0.698	anatomical structure morphogenesis
GO:0097435	0.686	supramolecular fiber organization
GO:0061061	0.684	muscle structure development
GO:0022607	0.638	cellular component assembly
GO:0048869	0.576	cellular developmental process
GO:0030154	0.571	cell differentiation
GO:0048468	0.539	cell development
GO:0032989	0.459	cellular component morphogenesis
GO:0051239	0.413	regulation of multicellular organismal process
GO:0051179	0.411	localization
GO:0007275	0.355	multicellular organism development
GO:0048646	0.342	anatomical structure formation involved in morphogenesis
GO:0048518	0.338	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0032991	0.995	protein-containing complex
GO:0005829	0.986	cytosol
GO:0005856	0.985	cytoskeleton
GO:0043292	0.985	contractile fiber
GO:0015629	0.982	actin cytoskeleton
GO:0016459	0.949	myosin complex
GO:0016460	0.944	myosin II complex
GO:0043227	0.865	membrane-bounded organelle
GO:0043231	0.761	intracellular membrane-bounded organelle
GO:0070062	0.635	extracellular exosome
GO:0030016	0.393	myofibril
GO:0005859	0.369	muscle myosin complex
GO:0016020	0.349	membrane
GO:0071944	0.333	cell periphery
GO:0030017	0.326	sarcomere
GO:0042641	0.319	actomyosin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]