StarFunc result for job id P24863

User Input

>input (283 residues)
MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQ
VIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRF
SYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIV
NDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQ
WKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1RBC9	0.980	0.980	1.078E-36	283	0.936	0.936	F1RBC9.pdb.gz
2	PDB:5hbhB	0.928	0.972	4.023E-32	270	0.933	0.978	5hbhB.pdb.gz	Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
3	AFDB:P25008	0.920	0.975	1.029E-28	267	0.678	0.719	P25008.pdb.gz	CCNC_DROME Cyclin-C OS=Drosophila melanogaster OX=7227 GN=CycC PE=1 SV=1
4	AFDB:Q86KE7	0.839	0.928	5.571E-16	255	0.385	0.427	Q86KE7.pdb.gz	CCNC_DICDI Cyclin-C OS=Dictyostelium discoideum OX=44689 GN=cycC PE=3 SV=1
5	AFDB:P47821	0.761	0.671	6.339E-13	323	0.332	0.291	P47821.pdb.gz	SSN8_YEAST RNA polymerase II holoenzyme cyclin-like subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSN8 PE=1 SV=1
6	AFDB:Q961D1	0.681	0.496	4.102E-11	400	0.286	0.203	Q961D1.pdb.gz	Q961D1_DROME Cyclin K, isoform A OS=Drosophila melanogaster OX=7227 GN=CycK PE=1 SV=1
7	AFDB:O94503	0.702	0.859	8.220E-11	228	0.247	0.307	O94503.pdb.gz	SRB11_SCHPO RNA polymerase II holoenzyme cyclin-like subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srb11 PE=1 SV=1
8	AFDB:Q5A4H9	0.634	0.422	8.966E-11	434	0.251	0.164	Q5A4H9.pdb.gz	SSN8_CANAL RNA polymerase II holoenzyme cyclin-like subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSN8 PE=3 SV=1
9	PDB:7kpvB	0.767	0.749	9.511E-11	290	0.307	0.300	7kpvB.pdb.gz
10	AFDB:Q8RWV3	0.735	0.511	5.805E-10	416	0.226	0.154	Q8RWV3.pdb.gz	CCL11_ARATH Cyclin-L1-1 OS=Arabidopsis thaliana OX=3702 GN=CYCL1-1 PE=1 SV=2
11	AFDB:O74627	0.733	0.613	6.332E-10	342	0.279	0.231	O74627.pdb.gz	CG1C_SCHPO Cyclin pch1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pch1 PE=1 SV=1
12	AFDB:F1QMB9	0.717	0.488	6.613E-10	425	0.293	0.195	F1QMB9.pdb.gz	CCNK_DANRE Cyclin-K OS=Danio rerio OX=7955 GN=ccnk PE=2 SV=3
13	PDB:1zp2A	0.630	0.772	3.986E-9	227	0.240	0.300	1zp2A.pdb.gz
14	PDB:7kueB	0.624	0.769	3.815E-8	225	0.226	0.284	7kueB.pdb.gz	Structure of TFIIK for phosphorylation of CTD of RNA polymerase II.
15	PDB:7egb9	0.696	0.687	5.640E-8	287	0.223	0.220	7egb9.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
16	PDB:6gzhB	0.689	0.770	4.160E-7	252	0.184	0.206	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
17	PDB:7jv7B	0.629	0.578	5.396E-6	310	0.145	0.132	7jv7B.pdb.gz
18	PDB:7nj0C	0.624	0.651	3.067E-5	270	0.131	0.137	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
19	PDB:2w96A	0.570	0.638	1.231E-4	249	0.134	0.153	2w96A.pdb.gz
20	PDB:7b5lY	0.589	0.652	1.669E-4	253	0.145	0.162	7b5lY.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P24863	0.0	590	283	1.000	1.000	CCNC_HUMAN Cyclin-C OS=Homo sapiens OX=9606 GN=CCNC PE=1 SV=2
2	P39947	0.0	566	278	0.968	0.986	CCNC_RAT Cyclin-C OS=Rattus norvegicus OX=10116 GN=Ccnc PE=2 SV=2
3	Q62447	0.0	587	283	0.993	0.993	CCNC_MOUSE Cyclin-C OS=Mus musculus OX=10090 GN=Ccnc PE=2 SV=4
4	Q6STL0	0.0	520	283	0.898	0.898	Q6STL0_DANRE Cyclin-C OS=Danio rerio OX=7955 GN=CCNC PE=2 SV=1
5	P25008	8.57e-139	394	267	0.654	0.693	CCNC_DROME Cyclin-C OS=Drosophila melanogaster OX=7227 GN=CycC PE=1 SV=1
6	Q86KE7	1.16e-67	213	255	0.382	0.424	CCNC_DICDI Cyclin-C OS=Dictyostelium discoideum OX=44689 GN=cycC PE=3 SV=1
7	P47821	3.12e-32	123	323	0.314	0.276	SSN8_YEAST RNA polymerase II holoenzyme cyclin-like subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSN8 PE=1 SV=1
8	Q5A4H9	4.27e-31	122	434	0.265	0.173	SSN8_CANAL RNA polymerase II holoenzyme cyclin-like subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSN8 PE=3 SV=1
9	O94503	3.20e-23	97.1	228	0.265	0.329	SRB11_SCHPO RNA polymerase II holoenzyme cyclin-like subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srb11 PE=1 SV=1
10	Q961D1	2.14e-20	92.0	400	0.300	0.212	Q961D1_DROME Cyclin K, isoform A OS=Drosophila melanogaster OX=7227 GN=CycK PE=1 SV=1
11	O74627	3.64e-20	90.9	342	0.272	0.225	CG1C_SCHPO Cyclin pch1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pch1 PE=1 SV=1
12	Q8GYM6	5.47e-19	88.6	541	0.247	0.129	CCT14_ARATH Cyclin-T1-4 OS=Arabidopsis thaliana OX=3702 GN=CYCT1-4 PE=1 SV=1
13	F4KD43	1.03e-17	85.1	590	0.212	0.102	F4KD43_ARATH Cyclin family protein OS=Arabidopsis thaliana OX=3702 GN=CYCT1:5 PE=1 SV=1
14	F1QMB9	1.25e-17	84.3	425	0.276	0.184	CCNK_DANRE Cyclin-K OS=Danio rerio OX=7955 GN=ccnk PE=2 SV=3
15	Q9JJA7	1.29e-16	81.6	518	0.240	0.131	CCNL2_MOUSE Cyclin-L2 OS=Mus musculus OX=10090 GN=Ccnl2 PE=1 SV=1
16	Q5I0H5	1.31e-16	81.6	520	0.240	0.131	CCNL2_RAT Cyclin-L2 OS=Rattus norvegicus OX=10116 GN=Ccnl2 PE=1 SV=2
17	Q8RWV3	1.92e-16	80.9	416	0.212	0.144	CCL11_ARATH Cyclin-L1-1 OS=Arabidopsis thaliana OX=3702 GN=CYCL1-1 PE=1 SV=2
18	Q96S94	1.11e-15	79.0	520	0.237	0.129	CCNL2_HUMAN Cyclin-L2 OS=Homo sapiens OX=9606 GN=CCNL2 PE=1 SV=1
19	O88874	1.37e-15	78.6	554	0.290	0.148	CCNK_MOUSE Cyclin-K OS=Mus musculus OX=10090 GN=Ccnk PE=1 SV=3
20	O17144	6.83e-15	75.5	325	0.208	0.182	O17144_DROME Cyclin-H (Fragment) OS=Drosophila melanogaster OX=7227 GN=CycH PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02984 Cyclin_C	91	14.6	Cyclin, C-terminal domain
2	PF16899 Cyclin_C_2	0.035	25.8	Cyclin C-terminal domain
3	PF00134 Cyclin_N	9.4e-11	53.0	Cyclin, N-terminal domain
4	PF00382 TFIIB	1.1	20.7	Transcription factor TFIIB repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010365990.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010358488.1	0.999	Belongs to the protein kinase superfamily.
2	61622.XP_010355655.1	0.994	Mediator of RNA polymerase II transcription subunit 17
3	61622.XP_010362393.1	0.994	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
4	61622.XP_010361719.1	0.993	Mediator of RNA polymerase II transcription subunit 7
5	61622.XP_010374320.1	0.993	Mediator of RNA polymerase II transcription subunit 10
6	61622.XP_010380008.1	0.993	Mediator of RNA polymerase II transcription subunit 28 isoform X1
7	61622.XP_010358930.1	0.992	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
8	61622.XP_010364325.1	0.991	Cyclin dependent kinase 19
9	61622.XP_010378650.1	0.991	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
10	61622.XP_010377616.1	0.990	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
11	61622.XP_010378437.1	0.989	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
12	61622.XP_010370181.1	0.987	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
13	61622.XP_010376191.1	0.987	Mediator of RNA polymerase II transcription subunit 31
14	61622.XP_010361488.1	0.986	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
15	61622.XP_010378162.1	0.986	Mediator of RNA polymerase II transcription subunit 21
16	61622.XP_010381107.1	0.986	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
17	61622.XP_010355907.1	0.985	Mediator of RNA polymerase II transcription subunit 23 isoform X1
18	61622.XP_010373228.1	0.985	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
19	61622.XP_010371140.1	0.984	Mediator of RNA polymerase II transcription subunit 27 isoform X1
20	61622.XP_010367949.1	0.980	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.996	identical protein binding
GO:0003824	0.829	catalytic activity
GO:0016538	0.739	cyclin-dependent protein serine/threonine kinase regulator activity
GO:0019787	0.727	ubiquitin-like protein transferase activity
GO:0061659	0.650	ubiquitin-like protein ligase activity
GO:0140110	0.455	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0071704	0.920	organic substance metabolic process
GO:0044238	0.918	primary metabolic process
GO:0006807	0.900	nitrogen compound metabolic process
GO:0019222	0.896	regulation of metabolic process
GO:0080090	0.878	regulation of primary metabolic process
GO:0031323	0.878	regulation of cellular metabolic process
GO:0043170	0.823	macromolecule metabolic process
GO:0032502	0.813	developmental process
GO:0048856	0.803	anatomical structure development
GO:0032501	0.802	multicellular organismal process
GO:0044237	0.744	cellular metabolic process
GO:0060255	0.721	regulation of macromolecule metabolic process
GO:0048519	0.718	negative regulation of biological process
GO:0048523	0.705	negative regulation of cellular process
GO:0048583	0.702	regulation of response to stimulus
GO:0051171	0.652	regulation of nitrogen compound metabolic process
GO:0007275	0.606	multicellular organism development
GO:0023051	0.570	regulation of signaling
GO:0009966	0.561	regulation of signal transduction
GO:0009889	0.507	regulation of biosynthetic process
GO:0061318	0.483	renal filtration cell differentiation
GO:0031326	0.466	regulation of cellular biosynthetic process
GO:0061005	0.449	cell differentiation involved in kidney development
GO:0048518	0.447	positive regulation of biological process
GO:0010556	0.446	regulation of macromolecule biosynthetic process
GO:1901564	0.439	organonitrogen compound metabolic process
GO:0030855	0.439	epithelial cell differentiation
GO:0072006	0.433	nephron development
GO:0072073	0.433	kidney epithelium development
GO:0048522	0.410	positive regulation of cellular process
GO:0019219	0.405	regulation of nucleobase-containing compound metabolic process
GO:0008593	0.403	regulation of Notch signaling pathway
GO:0010468	0.391	regulation of gene expression
GO:0072311	0.383	glomerular epithelial cell differentiation
GO:0002064	0.360	epithelial cell development
GO:0051252	0.353	regulation of RNA metabolic process
GO:0009893	0.332	positive regulation of metabolic process
GO:0006355	0.327	regulation of DNA-templated transcription
GO:0019538	0.324	protein metabolic process
GO:0043412	0.318	macromolecule modification
GO:0072310	0.314	glomerular epithelial cell development
GO:0031325	0.312	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:1990234	0.994	transferase complex
GO:0140513	0.909	nuclear protein-containing complex
GO:0061695	0.716	transferase complex, transferring phosphorus-containing groups
GO:0005737	0.697	cytoplasm
GO:1902554	0.542	serine/threonine protein kinase complex
GO:0016592	0.475	mediator complex
GO:0000307	0.468	cyclin-dependent protein kinase holoenzyme complex
GO:0140535	0.404	intracellular protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.727	Transferases.

[back to server]