StarFunc result for job id P24864

User Input

>input (410 residues)
MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQ
PWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIM
LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR
LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA
ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI
QTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P24864	1.000	1.000	9.966E-56	410	1.000	1.000	P24864.pdb.gz	CCNE1_HUMAN G1/S-specific cyclin-E1 OS=Homo sapiens OX=9606 GN=CCNE1 PE=1 SV=2
2	AFDB:P39949	0.723	0.722	8.499E-46	411	0.798	0.796	P39949.pdb.gz	CCNE1_RAT G1/S-specific cyclin-E1 OS=Rattus norvegicus OX=10116 GN=Ccne1 PE=1 SV=2
3	AFDB:P47794	0.716	0.716	2.997E-37	410	0.580	0.580	P47794.pdb.gz	CCNE1_DANRE G1/S-specific cyclin-E1 OS=Danio rerio OX=7955 GN=ccne1 PE=2 SV=1
4	AFDB:C9J2U0	0.323	0.377	8.542E-37	350	0.844	0.989	C9J2U0.pdb.gz	C9J2U0_HUMAN Cyclin E variant ex7del OS=Homo sapiens OX=9606 GN=CCNE1 PE=1 SV=3
5	AFDB:D3ZQ41	0.712	0.720	3.514E-30	405	0.456	0.462	D3ZQ41.pdb.gz	D3ZQ41_RAT Cyclin E2 OS=Rattus norvegicus OX=10116 GN=Ccne2 PE=3 SV=1
6	AFDB:P54733	0.660	0.388	2.974E-25	709	0.385	0.223	P54733.pdb.gz	CCNE_DROME G1/S-specific cyclin-E OS=Drosophila melanogaster OX=7227 GN=CycE PE=1 SV=2
7	AFDB:O01501	0.640	0.506	1.062E-19	524	0.254	0.198	O01501.pdb.gz	CCNE_CAEEL G1/S-specific cyclin-E OS=Caenorhabditis elegans OX=6239 GN=cye-1 PE=1 SV=2
8	AFDB:Q39069	0.488	0.484	5.436E-13	414	0.207	0.205	Q39069.pdb.gz	CCB13_ARATH Cyclin-B1-3 OS=Arabidopsis thaliana OX=3702 GN=CYCB1-3 PE=2 SV=2
9	AFDB:P20248	0.496	0.473	7.707E-13	432	0.188	0.178	P20248.pdb.gz	CCNA2_HUMAN Cyclin-A2 OS=Homo sapiens OX=9606 GN=CCNA2 PE=1 SV=2
10	AFDB:Q9C6A9	0.492	0.539	8.051E-13	372	0.195	0.215	Q9C6A9.pdb.gz	CCA32_ARATH Cyclin-A3-2 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-2 PE=2 SV=1
11	PDB:7nj0C	0.483	0.714	3.731E-9	270	0.168	0.256	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
12	PDB:2w96A	0.461	0.732	4.847E-9	249	0.137	0.225	2w96A.pdb.gz
13	PDB:7b5lY	0.479	0.759	7.834E-9	253	0.154	0.249	7b5lY.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
14	PDB:3g33B	0.468	0.806	5.583E-8	229	0.141	0.253	3g33B.pdb.gz
15	PDB:1g3nC	0.466	0.791	2.806E-7	233	0.095	0.167	1g3nC.pdb.gz
16	PDB:1zp2A	0.343	0.580	2.250E-3	227	0.085	0.154	1zp2A.pdb.gz
17	PDB:6gzhB	0.315	0.478	1.346E-2	252	0.093	0.151	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
18	PDB:7jv7B	0.359	0.456	2.480E-2	310	0.080	0.106	7jv7B.pdb.gz
19	PDB:7kueB	0.230	0.385	2.707E-2	225	0.088	0.160	7kueB.pdb.gz	Structure of TFIIK for phosphorylation of CTD of RNA polymerase II.
20	PDB:7kpvB	0.342	0.466	3.367E-2	290	0.066	0.093	7kpvB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9J2U0	0.0	711	350	0.854	1.000	C9J2U0_HUMAN Cyclin E variant ex7del OS=Homo sapiens OX=9606 GN=CCNE1 PE=1 SV=3
2	P24864	0.0	855	410	1.000	1.000	CCNE1_HUMAN G1/S-specific cyclin-E1 OS=Homo sapiens OX=9606 GN=CCNE1 PE=1 SV=2
3	P39949	0.0	700	411	0.798	0.796	CCNE1_RAT G1/S-specific cyclin-E1 OS=Rattus norvegicus OX=10116 GN=Ccne1 PE=1 SV=2
4	Q61457	0.0	687	408	0.783	0.787	CCNE1_MOUSE G1/S-specific cyclin-E1 OS=Mus musculus OX=10090 GN=Ccne1 PE=1 SV=2
5	P47794	2.05e-171	487	410	0.573	0.573	CCNE1_DANRE G1/S-specific cyclin-E1 OS=Danio rerio OX=7955 GN=ccne1 PE=2 SV=1
6	I3L1Q9	2.22e-158	446	215	0.524	1.000	I3L1Q9_HUMAN Cyclin E1 (Fragment) OS=Homo sapiens OX=9606 GN=CCNE1 PE=1 SV=8
7	O96020	1.52e-125	370	404	0.451	0.458	CCNE2_HUMAN G1/S-specific cyclin-E2 OS=Homo sapiens OX=9606 GN=CCNE2 PE=1 SV=1
8	A0A8I6A291	1.51e-120	357	404	0.461	0.468	A0A8I6A291_RAT Cyclin E2 OS=Rattus norvegicus OX=10116 GN=Ccne2 PE=3 SV=1
9	D3ZQ41	1.60e-120	357	405	0.461	0.467	D3ZQ41_RAT Cyclin E2 OS=Rattus norvegicus OX=10116 GN=Ccne2 PE=3 SV=1
10	Q9Z238	3.57e-120	357	404	0.461	0.468	CCNE2_MOUSE G1/S-specific cyclin-E2 OS=Mus musculus OX=10090 GN=Ccne2 PE=1 SV=1
11	P54733	3.24e-87	281	709	0.363	0.210	CCNE_DROME G1/S-specific cyclin-E OS=Drosophila melanogaster OX=7227 GN=CycE PE=1 SV=2
12	O01501	1.00e-47	172	524	0.232	0.181	CCNE_CAEEL G1/S-specific cyclin-E OS=Caenorhabditis elegans OX=6239 GN=cye-1 PE=1 SV=2
13	P43449	7.74e-28	115	395	0.178	0.185	CCNA2_CHICK Cyclin-A2 OS=Gallus gallus OX=9031 GN=CCNA2 PE=1 SV=1
14	Q39067	3.51e-26	111	445	0.185	0.171	CCB12_ARATH Cyclin-B1-2 OS=Arabidopsis thaliana OX=3702 GN=CYCB1-2 PE=1 SV=2
15	Q3ECW2	4.68e-26	110	370	0.163	0.181	CCA34_ARATH Cyclin-A3-4 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-4 PE=1 SV=1
16	P30274	5.08e-26	110	430	0.163	0.156	CCNA2_BOVIN Cyclin-A2 OS=Bos taurus OX=9913 GN=CCNA2 PE=1 SV=2
17	Q9C6A9	6.22e-26	109	372	0.163	0.180	CCA32_ARATH Cyclin-A3-2 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-2 PE=2 SV=1
18	P20248	2.83e-25	108	432	0.156	0.148	CCNA2_HUMAN Cyclin-A2 OS=Homo sapiens OX=9606 GN=CCNA2 PE=1 SV=2
19	A0A0G2JVY9	4.08e-25	108	418	0.127	0.124	A0A0G2JVY9_RAT Cyclin-A2 OS=Rattus norvegicus OX=10116 GN=Ccna2 PE=3 SV=2
20	P51943	4.60e-25	108	422	0.127	0.123	CCNA2_MOUSE Cyclin-A2 OS=Mus musculus OX=10090 GN=Ccna2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02984 Cyclin_C	1e-16	72.5	Cyclin, C-terminal domain
2	PF00134 Cyclin_N	3.4e-38	141.7	Cyclin, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262643

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228872	0.999	Cyclin-dependent kinase inhibitor 1B
2	9606.ENSP00000266970	0.999	Cyclin-dependent kinase 2
3	9606.ENSP00000281708	0.999	F-box/WD repeat-containing protein 7
4	9606.ENSP00000378699	0.999	Cyclin-dependent kinase 1
5	9606.ENSP00000384849	0.999	Cyclin-dependent kinase inhibitor 1
6	9606.ENSP00000209728	0.995	Cell division control protein 6 homolog
7	9606.ENSP00000257904	0.995	Cyclin-dependent kinase 4
8	9606.ENSP00000267163	0.995	Retinoblastoma-associated protein
9	9606.ENSP00000303706	0.993	M-phase inducer phosphatase 1
10	9606.ENSP00000400088	0.991	TEN1-CDK3 readthrough (NMD candidate)
11	9606.ENSP00000368458	0.990	Proliferating cell nuclear antigen
12	9606.ENSP00000301019	0.984	DNA replication factor Cdt1
13	9606.ENSP00000262133	0.981	Retinoblastoma-like protein 2
14	9606.ENSP00000265734	0.981	Cyclin-dependent kinase 6
15	9606.ENSP00000342307	0.980	Forkhead box protein M1
16	9606.ENSP00000345571	0.980	Transcription factor E2F1
17	9606.ENSP00000362768	0.976	Retinoblastoma-like protein 1
18	9606.ENSP00000262904	0.975	Transcription factor E2F3
19	9606.ENSP00000413720	0.974	Cyclin-dependent kinase inhibitor 1C
20	9606.ENSP00000355249	0.972	Transcription factor E2F2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.655	enzyme binding
GO:0003824	0.436	catalytic activity
GO:0016538	0.355	cyclin-dependent protein serine/threonine kinase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0009987	0.995	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0044237	0.973	cellular metabolic process
GO:0006807	0.955	nitrogen compound metabolic process
GO:0048518	0.946	positive regulation of biological process
GO:0048522	0.937	positive regulation of cellular process
GO:0043412	0.934	macromolecule modification
GO:1901564	0.928	organonitrogen compound metabolic process
GO:0050896	0.898	response to stimulus
GO:0019222	0.882	regulation of metabolic process
GO:0022402	0.856	cell cycle process
GO:0080090	0.854	regulation of primary metabolic process
GO:0060255	0.854	regulation of macromolecule metabolic process
GO:0044770	0.854	cell cycle phase transition
GO:0031323	0.807	regulation of cellular metabolic process
GO:0051171	0.800	regulation of nitrogen compound metabolic process
GO:0008284	0.786	positive regulation of cell population proliferation
GO:0044843	0.772	cell cycle G1/S phase transition
GO:0000278	0.759	mitotic cell cycle
GO:0019538	0.759	protein metabolic process
GO:0006793	0.736	phosphorus metabolic process
GO:0036211	0.735	protein modification process
GO:1903047	0.673	mitotic cell cycle process
GO:0044772	0.574	mitotic cell cycle phase transition
GO:0051716	0.570	cellular response to stimulus
GO:0048519	0.535	negative regulation of biological process
GO:0007154	0.529	cell communication
GO:0071840	0.512	cellular component organization or biogenesis
GO:0006796	0.487	phosphate-containing compound metabolic process
GO:0016043	0.461	cellular component organization
GO:0000003	0.457	reproduction
GO:0019219	0.436	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.427	negative regulation of cellular process
GO:0051726	0.426	regulation of cell cycle
GO:0010468	0.390	regulation of gene expression
GO:0016310	0.389	phosphorylation
GO:0006468	0.382	protein phosphorylation
GO:0010556	0.380	regulation of macromolecule biosynthetic process
GO:0031326	0.380	regulation of cellular biosynthetic process
GO:0051252	0.367	regulation of RNA metabolic process
GO:0006355	0.357	regulation of DNA-templated transcription
GO:0023052	0.348	signaling
GO:0065009	0.303	regulation of molecular function
GO:0000082	0.300	G1/S transition of mitotic cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005829	0.985	cytosol
GO:0032991	0.971	protein-containing complex
GO:0043228	0.843	non-membrane-bounded organelle
GO:0043232	0.746	intracellular non-membrane-bounded organelle
GO:1902494	0.721	catalytic complex
GO:1990234	0.527	transferase complex
GO:0015630	0.343	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]