StarFunc result for job id P24928

User Input

>input (1970 residues)
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT
SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPASPKYTPTSPSYSPSSPEYTPTSPKY
SPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1nt9A	0.684	0.971	0.000	1383	0.376	0.536	1nt9A.pdb.gz
2	PDB:1pqvA	0.693	0.965	0.000	1409	0.385	0.539	1pqvA.pdb.gz
3	PDB:1twaA	0.627	0.899	0.000	1352	0.362	0.527	1twaA.pdb.gz	Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
4	PDB:3h0gA	0.709	0.928	0.000	1496	0.424	0.559	3h0gA.pdb.gz	Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
5	PDB:5fywA	0.695	0.977	0.000	1398	0.382	0.538	5fywA.pdb.gz	Transcription Initiation Complex Structures Elucidate DNA Opening
6	PDB:5vvsA	0.697	0.937	0.000	1455	0.390	0.528	5vvsA.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
7	PDB:6drdA	0.500	0.978	0.000	1000	0.505	0.995	6drdA.pdb.gz	Architecture of Pol II(G) and molecular mechanism of transcription regulation by Gdown1.
8	PDB:6o6cA	0.696	0.945	0.000	1446	0.386	0.526	6o6cA.pdb.gz	3.1 angstrom structure of yeast RNA polymerase II elongation complex stalled at a cyclobutane pyrimidine dimer lesion solved using streptavidin affinity grids.
9	PDB:6o9lA	0.713	0.944	0.000	1476	0.746	0.996	6o9lA.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
10	PDB:7lbmA	0.710	0.957	0.000	1455	0.728	0.986	7lbmA.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
11	AFDB:D4A5A6	0.822	0.822	0.000	1970	0.998	0.998	D4A5A6.pdb.gz	D4A5A6_RAT DNA-directed RNA polymerase subunit OS=Rattus norvegicus OX=10116 GN=Polr2a PE=1 SV=1
12	AFDB:P04052	0.760	0.793	0.000	1887	0.708	0.739	P04052.pdb.gz	RPB1_DROME DNA-directed RNA polymerase II subunit RPB1 OS=Drosophila melanogaster OX=7227 GN=RpII215 PE=3 SV=4
13	AFDB:P18616	0.731	0.782	0.000	1839	0.566	0.607	P18616.pdb.gz	NRPB1_ARATH DNA-directed RNA polymerase II subunit RPB1 OS=Arabidopsis thaliana OX=3702 GN=NRPB1 PE=1 SV=3
14	AFDB:F1SPM8	0.033	0.058	1.845E-1	968	0.066	0.135	F1SPM8.pdb.gz	AAK1_PIG AP2-associated protein kinase 1 OS=Sus scrofa OX=9823 GN=AAK1 PE=2 SV=2
15	AFDB:Q8IZD9	0.045	0.044	6.240	2030	0.087	0.085	Q8IZD9.pdb.gz	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
16	AFDB:P59764	0.040	0.040	7.529	1978	0.086	0.086	P59764.pdb.gz	DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus OX=10090 GN=Dock4 PE=1 SV=1
17	AFDB:B0JZI5	0.019	0.046	8.668	561	0.054	0.189	B0JZI5.pdb.gz
18	AFDB:Q54JC7	0.041	0.055	8.668	1347	0.059	0.087	Q54JC7.pdb.gz	Y1197_DICDI Probable serine/threonine-protein kinase DDB_G0288147 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0288147 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PUA6	0.0	1796	1728	0.485	0.553	A0A1D8PUA6_CANAL DNA-directed RNA polymerase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RPO21 PE=3 SV=1
2	A0A8I6ASE2	0.0	3998	1956	0.987	0.994	A0A8I6ASE2_RAT DNA-directed RNA polymerase subunit OS=Rattus norvegicus OX=10116 GN=Polr2a PE=1 SV=1
3	B8YB53	0.0	692	880	0.191	0.428	RPO1N_SACSH DNA-directed RNA polymerase subunit Rpo1N OS=Saccharolobus shibatae OX=2286 GN=rpo1N PE=1 SV=1
4	D4A5A6	0.0	4053	1970	0.998	0.998	D4A5A6_RAT DNA-directed RNA polymerase subunit OS=Rattus norvegicus OX=10116 GN=Polr2a PE=1 SV=1
5	G3MZY8	0.0	4053	1970	0.999	0.999	G3MZY8_BOVIN DNA-directed RNA polymerase subunit OS=Bos taurus OX=9913 GN=POLR2A PE=1 SV=2
6	O77375	0.0	617	2457	0.157	0.126	O77375_PLAF7 DNA-directed RNA polymerase subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0318200 PE=3 SV=1
7	P04050	0.0	1555	1733	0.414	0.470	RPB1_YEAST DNA-directed RNA polymerase II subunit RPB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPO21 PE=1 SV=2
8	P04052	0.0	2732	1887	0.673	0.702	RPB1_DROME DNA-directed RNA polymerase II subunit RPB1 OS=Drosophila melanogaster OX=7227 GN=RpII215 PE=3 SV=4
9	P08775	0.0	4052	1970	0.999	0.999	RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus OX=10090 GN=Polr2a PE=1 SV=3
10	P11512	0.0	704	880	0.190	0.426	RPO1N_SULAC DNA-directed RNA polymerase subunit Rpo1N OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=rpo1N PE=1 SV=2
11	P16356	0.0	2424	1856	0.579	0.614	RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis elegans OX=6239 GN=ama-1 PE=1 SV=3
12	P18616	0.0	1855	1839	0.524	0.561	NRPB1_ARATH DNA-directed RNA polymerase II subunit RPB1 OS=Arabidopsis thaliana OX=3702 GN=NRPB1 PE=1 SV=3
13	P24928	0.0	4056	1970	1.000	1.000	RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2
14	P35084	0.0	1816	1727	0.471	0.537	RPB1_DICDI DNA-directed RNA polymerase II subunit rpb1 OS=Dictyostelium discoideum OX=44689 GN=polr2a PE=2 SV=2
15	P36594	0.0	1721	1752	0.453	0.509	RPB1_SCHPO DNA-directed RNA polymerase II subunit rpb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpb1 PE=1 SV=1
16	Q26791	0.0	1078	1765	0.347	0.388	Q26791_9TRYP DNA-directed RNA polymerase subunit OS=Trypanosoma brucei OX=5691 PE=3 SV=1
17	Q57YU2	0.0	1078	1765	0.347	0.387	Q57YU2_TRYB2 DNA-directed RNA polymerase subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.170 PE=3 SV=1
18	Q584K3	0.0	1080	1765	0.347	0.388	Q584K3_TRYB2 DNA-directed RNA polymerase subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.400 PE=3 SV=1
19	Q980R2	0.0	695	880	0.192	0.431	RPO1N_SACS2 DNA-directed RNA polymerase subunit Rpo1N OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=rpo1N PE=1 SV=1
20	O14802	1.64e-179	585	1390	0.178	0.252	RPC1_HUMAN DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens OX=9606 GN=POLR3A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04997 RNA_pol_Rpb1_1	1.4e-105	364.7	RNA polymerase Rpb1, domain 1
2	PF00623 RNA_pol_Rpb1_2	2.9e-71	250.6	RNA polymerase Rpb1, domain 2
3	PF04983 RNA_pol_Rpb1_3	2.1e-46	169.2	RNA polymerase Rpb1, domain 3
4	PF05000 RNA_pol_Rpb1_4	9.1e-35	130.2	RNA polymerase Rpb1, domain 4
5	PF04998 RNA_pol_Rpb1_5	1.6e-97	337.7	RNA polymerase Rpb1, domain 5
6	PF04992 RNA_pol_Rpb1_6	5.5e-65	230.2	RNA polymerase Rpb1, domain 6
7	PF04990 RNA_pol_Rpb1_7	5e-51	183.8	RNA polymerase Rpb1, domain 7
8	PF05001 RNA_pol_Rpb1_R	2.2e-24	95.6	RNA polymerase Rpb1 C-terminal repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9978.XP_004594855.1

Rank	PPI partner	STRING score	Description
1	9978.XP_004577789.1	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC3
2	9978.XP_004580689.1	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC4
3	9978.XP_004583942.1	0.999	DNA-directed RNA polymerase II subunit RPB3
4	9978.XP_004587034.1	0.999	DNA-directed RNA polymerase II subunit RPB11-like isoform X1
5	9978.XP_004589572.1	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC2
6	9978.XP_004590920.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 mRNAs, 9 Proteins
7	9978.XP_004595089.1	0.999	DNA-directed RNA polymerase II subunit RPB9
8	9978.XP_004596945.1	0.999	DNA-directed RNA polymerase II subunit RPB7
9	9978.XP_004585511.1	0.997	DNA-directed RNA polymerases I, II, and III subunit RPABC1-like
10	9978.XP_004595692.1	0.997	DNA-directed RNA polymerases I, II, and III subunit RPABC1
11	9978.XP_004585474.1	0.996	DNA-directed RNA polymerases I, II, and III subunit RPABC5-like
12	9978.XP_004599305.1	0.996	Translation initiation factor IF-2-like
13	9978.XP_004593971.1	0.995	Transcription elongation factor SPT6
14	9978.XP_004577522.1	0.994	General transcription factor IIF subunit 2
15	9978.XP_004580652.1	0.994	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 12 Proteins
16	9978.XP_004586206.1	0.994	Cyclin-dependent kinase 7
17	9978.XP_004579702.1	0.993	RNA polymerase II subunit A C-terminal domain phosphatase
18	9978.XP_004582126.1	0.993	Transcription initiation factor IIB
19	9978.XP_004593603.1	0.993	Cyclin-dependent kinase 9
20	9978.XP_004595930.1	0.992	General transcription factor IIF subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003899	0.998	DNA-directed 5'-3' RNA polymerase activity
GO:0003677	0.996	DNA binding
GO:0001055	0.391	RNA polymerase II activity
GO:1990841	0.309	promoter-specific chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050896	0.987	response to stimulus
GO:0009628	0.983	response to abiotic stimulus
GO:0070482	0.967	response to oxygen levels
GO:0051716	0.934	cellular response to stimulus
GO:0014070	0.930	response to organic cyclic compound
GO:0071704	0.910	organic substance metabolic process
GO:0044238	0.896	primary metabolic process
GO:0044237	0.896	cellular metabolic process
GO:0043170	0.893	macromolecule metabolic process
GO:0006807	0.888	nitrogen compound metabolic process
GO:0071453	0.878	cellular response to oxygen levels
GO:0065007	0.835	biological regulation
GO:0050789	0.833	regulation of biological process
GO:0034641	0.823	cellular nitrogen compound metabolic process
GO:0050794	0.819	regulation of cellular process
GO:0010467	0.761	gene expression
GO:0090304	0.756	nucleic acid metabolic process
GO:0016070	0.743	RNA metabolic process
GO:0019222	0.656	regulation of metabolic process
GO:0060255	0.639	regulation of macromolecule metabolic process
GO:0009059	0.610	macromolecule biosynthetic process
GO:0044271	0.604	cellular nitrogen compound biosynthetic process
GO:0031323	0.594	regulation of cellular metabolic process
GO:0010468	0.582	regulation of gene expression
GO:0080090	0.560	regulation of primary metabolic process
GO:0051171	0.560	regulation of nitrogen compound metabolic process
GO:0034654	0.536	nucleobase-containing compound biosynthetic process
GO:0006351	0.507	DNA-templated transcription
GO:0019219	0.497	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.425	regulation of RNA metabolic process
GO:0048518	0.409	positive regulation of biological process
GO:0048522	0.383	positive regulation of cellular process
GO:0010604	0.382	positive regulation of macromolecule metabolic process
GO:0051173	0.330	positive regulation of nitrogen compound metabolic process
GO:0031325	0.324	positive regulation of cellular metabolic process
GO:0006366	0.319	transcription by RNA polymerase II
GO:0010628	0.316	positive regulation of gene expression
GO:0044260	0.309	cellular macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0032991	0.988	protein-containing complex
GO:0043232	0.972	intracellular non-membrane-bounded organelle
GO:1902494	0.886	catalytic complex
GO:1990234	0.880	transferase complex
GO:0005694	0.828	chromosome
GO:0000428	0.668	DNA-directed RNA polymerase complex
GO:0055029	0.653	nuclear DNA-directed RNA polymerase complex
GO:0005737	0.606	cytoplasm
GO:0016591	0.509	RNA polymerase II, holoenzyme
GO:0005665	0.409	RNA polymerase II, core complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.7.6	0.998	DNA-directed RNA polymerase.

[back to server]