StarFunc result for job id P25063

User Input

>input (80 residues)
MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGG
ALQSTASLFVVSLSLLHLYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P25063	1.000	1.000	5.978E-12	80	1.000	1.000	P25063.pdb.gz	CD24_HUMAN Signal transducer CD24 OS=Homo sapiens OX=9606 GN=CD24 PE=1 SV=3
2	AFDB:Q91W27	0.343	0.279	5.194	100	0.188	0.150	Q91W27.pdb.gz	TIP39_MOUSE Tuberoinfundibular peptide of 39 residues OS=Mus musculus OX=10090 GN=Pth2 PE=1 SV=1
3	AFDB:Q59VW7	0.271	0.092	5.610	268	0.212	0.063	Q59VW7.pdb.gz	TIM21_CANAL Mitochondrial import inner membrane translocase subunit TIM21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TIM21 PE=3 SV=1
4	AFDB:Q9NFB5	0.274	0.071	7.068	331	0.150	0.036	Q9NFB5.pdb.gz	Q9NFB5_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0100200 PE=4 SV=1
5	AFDB:C6KTF3	0.296	0.096	8.904	323	0.175	0.043	C6KTF3.pdb.gz	C6KTF3_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0632100 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P25063	1.29e-48	150	80	1.000	1.000	CD24_HUMAN Signal transducer CD24 OS=Homo sapiens OX=9606 GN=CD24 PE=1 SV=3
2	A0A087WU87	4.06e-32	108	88	0.750	0.682	A0A087WU87_HUMAN CD24 molecule (Fragment) OS=Homo sapiens OX=9606 GN=CD24 PE=1 SV=1
3	A0A087WW33	5.29e-31	107	122	0.713	0.467	A0A087WW33_HUMAN CD24 molecule (Fragment) OS=Homo sapiens OX=9606 GN=CD24 PE=1 SV=1
4	Q07490	1.41e-08	48.9	76	0.537	0.566	CD24_RAT Signal transducer CD24 OS=Rattus norvegicus OX=10116 GN=Cd24 PE=2 SV=1
5	P24807	2.65e-08	48.1	76	0.500	0.526	CD24_MOUSE Signal transducer CD24 OS=Mus musculus OX=10090 GN=Cd24 PE=1 SV=1
6	Q8BRM2	1.6	28.9	368	0.212	0.046	GORAB_MOUSE RAB6-interacting golgin OS=Mus musculus OX=10090 GN=Gorab PE=1 SV=1
7	Q5AT15	1.9	28.9	517	0.175	0.027	SST_EMENI Serine O-succinyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cysA PE=1 SV=1
8	Q8WQ85	3.2	28.1	1704	0.163	0.008	VILD_DICDI Villidin OS=Dictyostelium discoideum OX=44689 GN=vilA PE=1 SV=2
9	Q9FKW4	4.4	27.7	523	0.188	0.029	CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana OX=3702 GN=CPK28 PE=1 SV=1
10	Q925B3	9.3	26.9	1862	0.250	0.011	TRPM7_RAT Transient receptor potential cation channel subfamily M member 7 OS=Rattus norvegicus OX=10116 GN=Trpm7 PE=1 SV=2
11	Q9UT18	9.9	26.6	591	0.175	0.024	THI9_SCHPO Thiamine transporter thi9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=thi9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14984 CD24	3.8e-22	89.6	CD24 protein
2	PF06679 DUF1180	3e+02	13.2	Protein of unknown function (DUF1180)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483985

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263686	0.991	P-selectin
2	9606.ENSP00000345243	0.985	Sialic acid-binding Ig-like lectin 10
3	9606.ENSP00000345347	0.976	High mobility group protein B1
4	9606.ENSP00000346839	0.936	Fibronectin type III domain containing
5	9606.ENSP00000359077	0.886	Neural cell adhesion molecule L1
6	9606.ENSP00000398632	0.880	CD44 antigen
7	9606.ENSP00000426809	0.874	Prominin-1
8	9606.ENSP00000263735	0.845	Epithelial cell adhesion molecule
9	9606.ENSP00000377681	0.817	Ras GTPase-activating protein-binding protein 1
10	9606.ENSP00000297785	0.802	Retinal dehydrogenase 1
11	9606.ENSP00000269571	0.796	Receptor tyrosine-protein kinase erbB-2
12	9606.ENSP00000411355	0.776	Receptor-type tyrosine-protein phosphatase C
13	9606.ENSP00000363117	0.775	Tyrosine-protein kinase Fgr
14	9606.ENSP00000437940	0.756	B-lymphocyte antigen CD19
15	9606.ENSP00000386896	0.743	Integrin alpha-6
16	9606.ENSP00000226279	0.739	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
17	9606.ENSP00000261769	0.739	Cadherin-1
18	9606.ENSP00000236147	0.728	L-selectin
19	9606.ENSP00000259915	0.727	POU domain, class 5, transcription factor 1
20	9606.ENSP00000356024	0.726	Complement receptor type 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	0.997	protein kinase binding
GO:0030296	0.997	protein tyrosine kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.993	response to stimulus
GO:0048522	0.991	positive regulation of cellular process
GO:0044093	0.984	positive regulation of molecular function
GO:0060255	0.982	regulation of macromolecule metabolic process
GO:0048856	0.980	anatomical structure development
GO:0050865	0.980	regulation of cell activation
GO:0032501	0.979	multicellular organismal process
GO:0002682	0.978	regulation of immune system process
GO:0030155	0.978	regulation of cell adhesion
GO:0051716	0.977	cellular response to stimulus
GO:0002376	0.975	immune system process
GO:0007154	0.971	cell communication
GO:0023052	0.969	signaling
GO:0048583	0.965	regulation of response to stimulus
GO:0022407	0.962	regulation of cell-cell adhesion
GO:0051249	0.962	regulation of lymphocyte activation
GO:0043085	0.960	positive regulation of catalytic activity
GO:0009893	0.960	positive regulation of metabolic process
GO:0032944	0.960	regulation of mononuclear cell proliferation
GO:0007165	0.958	signal transduction
GO:0051171	0.957	regulation of nitrogen compound metabolic process
GO:0045785	0.957	positive regulation of cell adhesion
GO:0080090	0.956	regulation of primary metabolic process
GO:0022409	0.952	positive regulation of cell-cell adhesion
GO:0010629	0.950	negative regulation of gene expression
GO:0042221	0.949	response to chemical
GO:0070727	0.949	cellular macromolecule localization
GO:0050867	0.949	positive regulation of cell activation
GO:0050670	0.949	regulation of lymphocyte proliferation
GO:0030154	0.948	cell differentiation
GO:0007275	0.948	multicellular organism development
GO:0050863	0.946	regulation of T cell activation
GO:0051251	0.944	positive regulation of lymphocyte activation
GO:0070665	0.941	positive regulation of leukocyte proliferation
GO:0006950	0.939	response to stress
GO:0051246	0.939	regulation of protein metabolic process
GO:1903039	0.935	positive regulation of leukocyte cell-cell adhesion
GO:0023051	0.932	regulation of signaling
GO:0010646	0.932	regulation of cell communication
GO:0051247	0.930	positive regulation of protein metabolic process
GO:0050870	0.930	positive regulation of T cell activation
GO:0048584	0.928	positive regulation of response to stimulus
GO:0042327	0.928	positive regulation of phosphorylation
GO:0001817	0.927	regulation of cytokine production
GO:0007166	0.927	cell surface receptor signaling pathway
GO:0042129	0.921	regulation of T cell proliferation
GO:0050793	0.919	regulation of developmental process
GO:1902533	0.919	positive regulation of intracellular signal transduction
GO:0001775	0.918	cell activation
GO:0001934	0.918	positive regulation of protein phosphorylation
GO:0050776	0.914	regulation of immune response
GO:0048731	0.913	system development
GO:0050671	0.912	positive regulation of lymphocyte proliferation
GO:0051241	0.908	negative regulation of multicellular organismal process
GO:0008104	0.903	protein localization
GO:0048513	0.900	animal organ development
GO:0051338	0.878	regulation of transferase activity
GO:0045595	0.866	regulation of cell differentiation
GO:0043408	0.865	regulation of MAPK cascade
GO:0042102	0.862	positive regulation of T cell proliferation
GO:0007155	0.857	cell adhesion
GO:2000026	0.852	regulation of multicellular organismal development
GO:0043549	0.848	regulation of kinase activity
GO:0045597	0.836	positive regulation of cell differentiation
GO:0051234	0.831	establishment of localization
GO:0006810	0.818	transport
GO:0043410	0.815	positive regulation of MAPK cascade
GO:0009888	0.801	tissue development
GO:0065008	0.795	regulation of biological quality
GO:0045859	0.777	regulation of protein kinase activity
GO:0072009	0.737	nephron epithelium development
GO:0008152	0.735	metabolic process
GO:0071840	0.727	cellular component organization or biogenesis
GO:0048523	0.727	negative regulation of cellular process
GO:0016043	0.708	cellular component organization
GO:0010033	0.707	response to organic substance
GO:0071702	0.693	organic substance transport
GO:0061005	0.650	cell differentiation involved in kidney development
GO:0072010	0.645	glomerular epithelium development
GO:0072311	0.620	glomerular epithelial cell differentiation
GO:0061318	0.592	renal filtration cell differentiation
GO:0051347	0.528	positive regulation of transferase activity
GO:0072112	0.494	podocyte differentiation
GO:0045184	0.487	establishment of protein localization
GO:0045860	0.430	positive regulation of protein kinase activity
GO:0051252	0.351	regulation of RNA metabolic process
GO:0071900	0.351	regulation of protein serine/threonine kinase activity
GO:0071705	0.345	nitrogen compound transport
GO:0010556	0.345	regulation of macromolecule biosynthetic process
GO:0031326	0.345	regulation of cellular biosynthetic process
GO:2001141	0.343	regulation of RNA biosynthetic process
GO:0015031	0.342	protein transport
GO:0046907	0.336	intracellular transport
GO:0009628	0.329	response to abiotic stimulus
GO:0071704	0.327	organic substance metabolic process
GO:0043405	0.321	regulation of MAP kinase activity
GO:0071634	0.312	regulation of transforming growth factor beta production
GO:0048468	0.310	cell development
GO:1903506	0.306	regulation of nucleic acid-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0009986	0.999	cell surface
GO:0005886	0.947	plasma membrane
GO:0098857	0.776	membrane microdomain
GO:0005737	0.748	cytoplasm
GO:0045121	0.686	membrane raft
GO:0070013	0.438	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]