StarFunc result for job id P25090

User Input

>input (351 residues)
METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P25090	1.000	1.000	4.603E-48	351	1.000	1.000	P25090.pdb.gz	FPR2_HUMAN N-formyl peptide receptor 2 OS=Homo sapiens OX=9606 GN=FPR2 PE=1 SV=2
2	AFDB:O88536	0.924	0.924	3.111E-40	351	0.761	0.761	O88536.pdb.gz	FPR2_MOUSE Formyl peptide receptor 2 OS=Mus musculus OX=10090 GN=Fpr2 PE=1 SV=1
3	AFDB:D4A8L8	0.914	0.914	1.161E-35	351	0.658	0.658	D4A8L8.pdb.gz	D4A8L8_RAT Formyl peptide receptor 3 OS=Rattus norvegicus OX=10116 GN=Fpr3 PE=3 SV=2
4	PDB:6lw5A	0.806	0.668	5.280E-35	427	0.903	0.742	6lw5A.pdb.gz	Structural basis of ligand binding modes at the human formyl peptide receptor 2.
5	AFDB:O08790	0.828	0.828	9.753E-34	351	0.735	0.735	O08790.pdb.gz	FPRS1_MOUSE Formyl peptide receptor-related sequence 1 OS=Mus musculus OX=10090 GN=Fpr-s1 PE=1 SV=2
6	AFDB:P25089	0.830	0.826	3.480E-33	353	0.724	0.720	P25089.pdb.gz	FPR3_HUMAN N-formyl peptide receptor 3 OS=Homo sapiens OX=9606 GN=FPR3 PE=2 SV=2
7	AFDB:P21462	0.854	0.857	2.735E-32	350	0.687	0.689	P21462.pdb.gz	FPR1_HUMAN fMet-Leu-Phe receptor OS=Homo sapiens OX=9606 GN=FPR1 PE=1 SV=3
8	AFDB:P33766	0.815	0.787	4.841E-30	364	0.644	0.621	P33766.pdb.gz	FPR1_MOUSE fMet-Leu-Phe receptor OS=Mus musculus OX=10090 GN=Fpr1 PE=2 SV=1
9	AFDB:D4A7Q2	0.825	0.816	9.348E-30	355	0.644	0.637	D4A7Q2.pdb.gz	D4A7Q2_RAT Formyl peptide receptor 1 OS=Rattus norvegicus OX=10116 GN=Fpr1 PE=3 SV=1
10	AFDB:O88537	0.809	0.827	1.164E-29	343	0.652	0.668	O88537.pdb.gz	FPRS3_MOUSE Formyl peptide receptor-related sequence 3 OS=Mus musculus OX=10090 GN=Fpr-rs3 PE=2 SV=2
11	AFDB:A4FUQ5	0.805	0.872	3.193E-29	323	0.613	0.666	A4FUQ5.pdb.gz	FPRS4_MOUSE Formyl peptide receptor-related sequence 4 OS=Mus musculus OX=10090 GN=Fpr-rs4 PE=2 SV=2
12	PDB:7wvuR	0.776	0.907	2.252E-26	298	0.598	0.705	7wvuR.pdb.gz	Structural basis of FPR2 in recognition of A beta 42 and neuroprotection by humanin.
13	PDB:7vktA	0.684	0.827	6.921E-15	287	0.248	0.303	7vktA.pdb.gz	Structural basis of leukotriene B4 receptor 1 activation.
14	PDB:8ef5M	0.664	0.798	2.364E-14	288	0.256	0.312	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.
15	PDB:7wicR	0.669	0.804	6.482E-14	288	0.242	0.295	7wicR.pdb.gz	Structures of the endogenous peptide- and selective non-peptide agonist-bound SSTR2 signaling complexes.
16	PDB:6lfmR	0.688	0.778	5.811E-13	307	0.271	0.309	6lfmR.pdb.gz	Structural basis of CXC chemokine receptor 2 activation and signalling.
17	PDB:7sk8A	0.660	0.750	6.344E-13	306	0.236	0.271	7sk8A.pdb.gz	Structures of atypical chemokine receptor 3 reveal the basis for its promiscuity and signaling bias.
18	PDB:7vl9R	0.679	0.781	9.837E-13	302	0.236	0.275	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
19	PDB:7wq3R	0.644	0.771	1.525E-12	289	0.228	0.277	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
20	PDB:7eibA	0.690	0.812	1.665E-12	295	0.234	0.278	7eibA.pdb.gz	Molecular basis for kinin selectivity and activation of the human bradykinin receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AM80	0.0	555	351	0.758	0.758	A0A8I6AM80_RAT Formyl peptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Fpr2 PE=3 SV=1
2	O88536	0.0	542	351	0.761	0.761	FPR2_MOUSE Formyl peptide receptor 2 OS=Mus musculus OX=10090 GN=Fpr2 PE=1 SV=1
3	P25089	0.0	518	353	0.726	0.722	FPR3_HUMAN N-formyl peptide receptor 3 OS=Homo sapiens OX=9606 GN=FPR3 PE=2 SV=2
4	P25090	0.0	712	351	1.000	1.000	FPR2_HUMAN N-formyl peptide receptor 2 OS=Homo sapiens OX=9606 GN=FPR2 PE=1 SV=2
5	O08790	8.76e-180	503	351	0.735	0.735	FPRS1_MOUSE Formyl peptide receptor-related sequence 1 OS=Mus musculus OX=10090 GN=Fpr-s1 PE=1 SV=2
6	P21462	2.59e-174	489	350	0.687	0.689	FPR1_HUMAN fMet-Leu-Phe receptor OS=Homo sapiens OX=9606 GN=FPR1 PE=1 SV=3
7	D4A8L8	1.56e-165	467	351	0.658	0.658	D4A8L8_RAT Formyl peptide receptor 3 OS=Rattus norvegicus OX=10116 GN=Fpr3 PE=3 SV=2
8	P33766	8.26e-162	458	364	0.675	0.651	FPR1_MOUSE fMet-Leu-Phe receptor OS=Mus musculus OX=10090 GN=Fpr1 PE=2 SV=1
9	D4A7Q2	1.11e-155	442	355	0.652	0.645	D4A7Q2_RAT Formyl peptide receptor 1 OS=Rattus norvegicus OX=10116 GN=Fpr1 PE=3 SV=1
10	O88537	1.13e-155	442	343	0.652	0.668	FPRS3_MOUSE Formyl peptide receptor-related sequence 3 OS=Mus musculus OX=10090 GN=Fpr-rs3 PE=2 SV=2
11	A4FUQ5	1.41e-152	433	323	0.618	0.672	FPRS4_MOUSE Formyl peptide receptor-related sequence 4 OS=Mus musculus OX=10090 GN=Fpr-rs4 PE=2 SV=2
12	Q71MR7	4.22e-147	420	338	0.584	0.607	FPRS7_MOUSE Formyl peptide receptor-related sequence 7 OS=Mus musculus OX=10090 GN=Fpr-rs7 PE=2 SV=2
13	Q3SXG2	2.57e-146	418	339	0.587	0.608	FPRS6_MOUSE Formyl peptide receptor-related sequence 6 OS=Mus musculus OX=10090 GN=Fpr-rs6 PE=2 SV=1
14	E7FF45	1.68e-80	252	372	0.396	0.374	E7FF45_DANRE Chemokine-like receptor 1 OS=Danio rerio OX=7955 GN=fpr1 PE=3 SV=1
15	O75388	6.04e-64	209	356	0.353	0.348	GPR32_HUMAN Probable G-protein coupled receptor 32 OS=Homo sapiens OX=9606 GN=GPR32 PE=2 SV=1
16	O35786	6.77e-60	199	372	0.339	0.320	CML1_RAT Chemerin-like receptor 1 OS=Rattus norvegicus OX=10116 GN=Cmklr1 PE=1 SV=2
17	P97468	7.22e-59	196	371	0.342	0.323	CML1_MOUSE Chemerin-like receptor 1 OS=Mus musculus OX=10090 GN=Cmklr1 PE=1 SV=1
18	Q99788	1.84e-56	190	373	0.348	0.327	CML1_HUMAN Chemerin-like receptor 1 OS=Homo sapiens OX=9606 GN=CMKLR1 PE=1 SV=2
19	C1BI79	1.96e-54	184	358	0.330	0.324	C1BI79_ONCMY Chemokine receptor-like 1 OS=Oncorhynchus mykiss OX=8022 GN=CML1 PE=2 SV=1
20	Q9Z2J6	1.63e-53	182	382	0.333	0.306	PD2R2_MOUSE Prostaglandin D2 receptor 2 OS=Mus musculus OX=10090 GN=Ptgdr2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	1.7e-35	134.1	7 transmembrane receptor (rhodopsin family)
2	PF10328 7TM_GPCR_Srx	1.7e+02	13.2	Serpentine type 7TM GPCR chemoreceptor Srx
3	PF16857 RNA_pol_inhib	5.5e+02	11.8	RNA polymerase inhibitor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000468897

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366109	0.996	Annexin A1
2	9606.ENSP00000296435	0.991	Cathelicidin antimicrobial peptide
3	9606.ENSP00000339328	0.989	Urokinase plasminogen activator surface receptor
4	9606.ENSP00000471493	0.967	fMet-Leu-Phe receptor
5	9606.ENSP00000341821	0.909	N-formyl peptide receptor 3
6	9606.ENSP00000384906	0.833	Serum amyloid A-1 protein
7	9606.ENSP00000343027	0.824	Guanine nucleotide-binding protein G(i) subunit alpha-1
8	9606.ENSP00000481878	0.824	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
9	9606.ENSP00000334448	0.800	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
10	9606.ENSP00000481357	0.759	C-C motif chemokine ligand 23
11	9606.ENSP00000482604	0.748	Hematopoietic SH2 domain-containing protein
12	9606.ENSP00000284981	0.717	Amyloid-beta A4 protein
13	9606.ENSP00000356213	0.710	VIP peptides
14	9606.ENSP00000275493	0.654	Epidermal growth factor receptor
15	9606.ENSP00000306512	0.653	Interleukin-8
16	9606.ENSP00000219919	0.648	Aquaporin-9
17	9606.ENSP00000260010	0.643	Toll-like receptor 2
18	9606.ENSP00000312082	0.641	Toll-like receptor 8
19	9606.ENSP00000014930	0.630	Heme-binding protein 1
20	9606.ENSP00000284551	0.630	E3 ubiquitin-protein ligase TRIM11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008528	1.000	G protein-coupled peptide receptor activity
GO:0005102	0.999	signaling receptor binding
GO:0042277	0.317	peptide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.996	signal transduction
GO:0006935	0.991	chemotaxis
GO:0007186	0.974	G protein-coupled receptor signaling pathway
GO:0048518	0.791	positive regulation of biological process
GO:0048522	0.551	positive regulation of cellular process
GO:0048583	0.511	regulation of response to stimulus
GO:0006950	0.490	response to stress
GO:0019222	0.457	regulation of metabolic process
GO:0002376	0.397	immune system process
GO:0070887	0.363	cellular response to chemical stimulus
GO:0048584	0.360	positive regulation of response to stimulus
GO:0010646	0.348	regulation of cell communication
GO:0023051	0.347	regulation of signaling
GO:0006952	0.333	defense response
GO:0048519	0.332	negative regulation of biological process
GO:0044419	0.329	biological process involved in interspecies interaction between organisms
GO:0010033	0.326	response to organic substance
GO:0009893	0.325	positive regulation of metabolic process
GO:0060255	0.323	regulation of macromolecule metabolic process
GO:0051707	0.320	response to other organism
GO:0009966	0.315	regulation of signal transduction
GO:0010604	0.302	positive regulation of macromolecule metabolic process
GO:0032501	0.301	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0012505	0.994	endomembrane system
GO:0005737	0.994	cytoplasm
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0030141	0.971	secretory granule
GO:0031090	0.959	organelle membrane
GO:0030659	0.951	cytoplasmic vesicle membrane
GO:0098588	0.929	bounding membrane of organelle
GO:0030667	0.833	secretory granule membrane
GO:0005576	0.807	extracellular region
GO:0070820	0.409	tertiary granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]