StarFunc result for job id P25092

User Input

>input (1073 residues)
MKTLLLDLALWSLLFQPGWLSFSSQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNE
GLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLI
GPSCTYSTFQMYLDTELSYPMISAGSFGLSCDYKETLTRLMSPARKLMYFLVNFWKTNDL
PFKTYSWSTSYVYKNGTETEDCFWYLNALEASVSYFSHELGFKVVLRQDKEFQDILMDHN
RKSNVIIMCGGPEFLYKLKGDRAVAEDIVIILVDLFNDQYFEDNVTAPDYMKNVLVLTLS
PGNSLLNSSFSRNLSPTKRDFALAYLNGILLFGHMLKIFLENGENITTPKFAHAFRNLTF
EGYDGPVTLDDWGDVDSTMVLLYTSVDTKKYKVLLTYDTHVNKTYPVDMSPTFTWKNSKL
PNDITGRGPQILMIAVFTLTGAVVLLLLVALLMLRKYRKDYELRQKKWSHIPPENIFPLE
TNETNHVSLKIDDDKRRDTIQRLRQCKYDKKRVILKDLKHNDGNFTEKQKIELNKLLQID
YYNLTKFYGTVKLDTMIFGVIEYCERGSLREVLNDTISYPDGTFMDWEFKISVLYDIAKG
MSYLHSSKTEVHGRLKSTNCVVDSRMVVKITDFGCNSILPPKKDLWTAPEHLRQANISQK
GDVYSYGIIAQEIILRKETFYTLSCRDRNEKIFRVENSNGMKPFRPDLFLETAEEKELEV
YLLVKNCWEEDPEKRPDFKKIETTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEHLVE
ERTQLYKAERDRADRLNFMLLPRLVVKSLKEKGFVEPELYEEVTIYFSDIVGFTTICKYS
TPMEVVDMLNDIYKSFDHIVDHHDVYKVETIGDAYMVASGLPKRNGNRHAIDIAKMALEI
LSFMGTFELEHLPGLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPL
RIHVSGSTIAILKRTECQFLYEVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQ
RLQAEFSDMIANSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTDKESTYF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23897	0.809	0.809	0.000	1072	0.826	0.826	P23897.pdb.gz	GUC2C_RAT Guanylyl cyclase C OS=Rattus norvegicus OX=10116 GN=Gucy2c PE=1 SV=2
2	AFDB:P25092	1.000	1.000	0.000	1073	1.000	1.000	P25092.pdb.gz	GUC2C_HUMAN Guanylyl cyclase C OS=Homo sapiens OX=9606 GN=GUCY2C PE=1 SV=2
3	AFDB:A0A0G2KGK2	0.346	0.351	9.003E-80	1051	0.297	0.304	A0A0G2KGK2.pdb.gz
4	AFDB:Q1LX84	0.541	0.543	1.454E-79	1067	0.308	0.309	Q1LX84.pdb.gz	Q1LX84_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=sGC PE=3 SV=1
5	AFDB:P16066	0.541	0.545	1.534E-79	1061	0.302	0.305	P16066.pdb.gz	ANPRA_HUMAN Atrial natriuretic peptide receptor 1 OS=Homo sapiens OX=9606 GN=NPR1 PE=1 SV=1
6	AFDB:E7F3T9	0.430	0.432	9.381E-79	1065	0.299	0.301	E7F3T9.pdb.gz
7	AFDB:P16067	0.430	0.436	1.685E-78	1047	0.298	0.306	P16067.pdb.gz	ANPRB_RAT Atrial natriuretic peptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Npr2 PE=1 SV=1
8	AFDB:B3DHF2	0.551	0.538	2.147E-76	1107	0.302	0.293	B3DHF2.pdb.gz	B3DHF2_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=RETGC-1 PE=2 SV=1
9	AFDB:Q6TL19	0.324	0.319	9.309E-74	1100	0.277	0.270	Q6TL19.pdb.gz	GUC2G_MOUSE Guanylate cyclase 2G OS=Mus musculus OX=10090 GN=Gucy2g PE=1 SV=1
10	AFDB:A0A0U1RPR8	0.377	0.367	3.719E-73	1117	0.296	0.285	A0A0U1RPR8.pdb.gz	GUC2D_MOUSE Guanylate cyclase D OS=Mus musculus OX=10090 GN=Gucy2d PE=2 SV=1
11	PDB:7d9rA	0.207	0.430	1.679E-19	502	0.086	0.183	7d9rA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
12	PDB:6jt0A	0.203	0.394	1.027E-18	542	0.087	0.172	6jt0A.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
13	PDB:6jt0B	0.208	0.376	4.103E-18	576	0.089	0.167	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
14	PDB:7d9tA	0.201	0.413	9.122E-18	512	0.089	0.186	7d9tA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
15	PDB:7yziA	0.203	0.549	9.122E-18	378	0.074	0.209	7yziA.pdb.gz	Structure of Mycobacterium tuberculosis Cya, an evolutionary ancestor of the mammalian membrane adenylyl cyclases.
16	PDB:2h8hA	0.209	0.473	6.936E-13	445	0.070	0.169	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
17	PDB:7c7sA	0.279	0.416	1.007E-12	685	0.071	0.111	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
18	PDB:5tosA	0.179	0.619	3.428E-12	280	0.051	0.196	5tosA.pdb.gz
19	PDB:6w2xB	0.264	0.398	6.160E-12	669	0.048	0.076	6w2xB.pdb.gz	Structures of metabotropic GABABreceptor.
20	PDB:8dksA	0.178	0.602	7.622E-12	283	0.057	0.216	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P23897	0.0	1845	1072	0.819	0.820	GUC2C_RAT Guanylyl cyclase C OS=Rattus norvegicus OX=10116 GN=Gucy2c PE=1 SV=2
2	P25092	0.0	2235	1073	1.000	1.000	GUC2C_HUMAN Guanylyl cyclase C OS=Homo sapiens OX=9606 GN=GUCY2C PE=1 SV=2
3	Q3UWA6	0.0	1824	1072	0.813	0.813	GUC2C_MOUSE Guanylyl cyclase C OS=Mus musculus OX=10090 GN=Gucy2c PE=2 SV=1
4	P16066	1.64e-144	462	1061	0.310	0.314	ANPRA_HUMAN Atrial natriuretic peptide receptor 1 OS=Homo sapiens OX=9606 GN=NPR1 PE=1 SV=1
5	B3DHF2	2.40e-143	460	1107	0.273	0.265	B3DHF2_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=RETGC-1 PE=2 SV=1
6	F1QWF7	7.10e-143	459	1103	0.273	0.266	F1QWF7_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=RETGC-1 PE=3 SV=2
7	P18293	3.80e-142	456	1057	0.305	0.309	ANPRA_MOUSE Atrial natriuretic peptide receptor 1 OS=Mus musculus OX=10090 GN=Npr1 PE=1 SV=2
8	P18910	1.60e-141	454	1057	0.302	0.307	ANPRA_RAT Atrial natriuretic peptide receptor 1 OS=Rattus norvegicus OX=10116 GN=Npr1 PE=1 SV=1
9	P20594	1.76e-136	441	1047	0.300	0.308	ANPRB_HUMAN Atrial natriuretic peptide receptor 2 OS=Homo sapiens OX=9606 GN=NPR2 PE=1 SV=1
10	Q1LX84	6.46e-136	439	1067	0.302	0.304	Q1LX84_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=sGC PE=3 SV=1
11	Q6VVW5	3.85e-135	437	1047	0.300	0.308	ANPRB_MOUSE Atrial natriuretic peptide receptor 2 OS=Mus musculus OX=10090 GN=Npr2 PE=1 SV=2
12	P16067	1.86e-134	435	1047	0.298	0.306	ANPRB_RAT Atrial natriuretic peptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Npr2 PE=1 SV=1
13	P51842	2.06e-134	436	1108	0.325	0.315	GUC2F_RAT Retinal guanylyl cyclase 2 OS=Rattus norvegicus OX=10116 GN=Gucy2f PE=1 SV=1
14	P51841	3.39e-134	436	1108	0.230	0.223	GUC2F_HUMAN Retinal guanylyl cyclase 2 OS=Homo sapiens OX=9606 GN=GUCY2F PE=1 SV=2
15	Q5SDA5	4.00e-134	436	1108	0.233	0.226	GUC2F_MOUSE Retinal guanylyl cyclase 2 OS=Mus musculus OX=10090 GN=Gucy2f PE=1 SV=1
16	P51840	1.93e-133	434	1108	0.223	0.216	GUC2E_RAT Retinal guanylyl cyclase 1 OS=Rattus norvegicus OX=10116 GN=Gucy2e PE=1 SV=1
17	O02740	2.17e-133	434	1103	0.232	0.226	GUC2F_BOVIN Retinal guanylyl cyclase 2 OS=Bos taurus OX=9913 GN=GUCY2F PE=1 SV=1
18	P52785	4.69e-132	430	1108	0.222	0.215	GUC2E_MOUSE Retinal guanylyl cyclase 1 OS=Mus musculus OX=10090 GN=Gucy2e PE=1 SV=2
19	P55203	3.59e-131	428	1110	0.217	0.210	GUC2D_BOVIN Retinal guanylyl cyclase 1 OS=Bos taurus OX=9913 GN=GUCY2D PE=1 SV=1
20	P51839	1.89e-130	426	1110	0.272	0.263	GUC2D_RAT Guanylate cyclase 2D OS=Rattus norvegicus OX=10116 GN=Gucy2d PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	0.68	20.6	Receptor family ligand binding region
2	PF00211 Guanylate_cyc	5.7e-64	226.6	Adenylate and Guanylate cyclase catalytic domain
3	PF06305 LapA_dom	3.6e+02	12.4	Lipopolysaccharide assembly protein A domain
4	PF00069 Pkinase	7.1e-24	96.2	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	3.5e-31	120.0	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261170

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349493	0.994	Guanylin
2	9606.ENSP00000361662	0.977	Guanylate cyclase activator 2B
3	9606.ENSP00000358857	0.909	Emerin
4	9606.ENSP00000369456	0.905	Inosine triphosphate pyrophosphatase
5	9606.ENSP00000368455	0.901	Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
6	9606.ENSP00000347742	0.873	Na(+)/H(+) exchange regulatory cofactor NHE-RF4
7	9606.ENSP00000347046	0.862	cGMP-specific 3',5'-cyclic phosphodiesterase
8	9606.ENSP00000419045	0.804	GTP cyclohydrolase 1
9	9606.ENSP00000362282	0.803	Molybdenum cofactor biosynthesis protein 1
10	9606.ENSP00000420295	0.789	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta
11	9606.ENSP00000334910	0.777	cGMP-dependent 3',5'-cyclic phosphodiesterase
12	9606.ENSP00000265074	0.768	Atrial natriuretic peptide receptor 3
13	9606.ENSP00000255266	0.757	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha
14	9606.ENSP00000377784	0.756	Guanylyl cyclase-activating protein 1
15	9606.ENSP00000264399	0.755	cGMP-dependent protein kinase 2
16	9606.ENSP00000286063	0.750	Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A
17	9606.ENSP00000438284	0.736	cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
18	9606.ENSP00000360502	0.733	Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha
19	9606.ENSP00000291539	0.729	High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A
20	9606.ENSP00000379496	0.713	Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004383	0.998	guanylate cyclase activity
GO:0005515	0.996	protein binding
GO:0036094	0.392	small molecule binding
GO:0043167	0.375	ion binding
GO:0043168	0.308	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.993	cellular process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0023052	0.967	signaling
GO:0007154	0.966	cell communication
GO:0051716	0.961	cellular response to stimulus
GO:0007165	0.931	signal transduction
GO:0007167	0.437	enzyme-linked receptor protein signaling pathway
GO:0008152	0.428	metabolic process
GO:0032501	0.334	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.789	organelle
GO:0043227	0.764	membrane-bounded organelle
GO:0120025	0.389	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13665	0.998	GTP = 3',5'-cyclic GMP + diphosphate
EC:4.6.1.2	0.998	guanylate cyclase.

[back to server]