StarFunc result for job id P25101

User Input

>input (427 residues)
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCM
LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRS
SHKDSMN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P25101	1.000	1.000	1.045E-56	427	1.000	1.000	P25101.pdb.gz	EDNRA_HUMAN Endothelin-1 receptor OS=Homo sapiens OX=9606 GN=EDNRA PE=1 SV=1
2	AFDB:A5JV23	0.752	0.761	1.847E-37	422	0.635	0.642	A5JV23.pdb.gz
3	AFDB:F8W4W1	0.778	0.814	9.659E-37	408	0.597	0.625	F8W4W1.pdb.gz
4	AFDB:P21451	0.736	0.712	1.122E-32	442	0.532	0.514	P21451.pdb.gz	EDNRB_RAT Endothelin receptor type B OS=Rattus norvegicus OX=10116 GN=Ednrb PE=2 SV=2
5	AFDB:Q9DGM2	0.730	0.731	1.457E-32	426	0.553	0.554	Q9DGM2.pdb.gz	Q9DGM2_DANRE Endothelin receptor type B OS=Danio rerio OX=7955 GN=ednrb1 PE=2 SV=1
6	AFDB:P24530	0.737	0.713	2.923E-32	442	0.532	0.514	P24530.pdb.gz	EDNRB_HUMAN Endothelin receptor type B OS=Homo sapiens OX=9606 GN=EDNRB PE=1 SV=1
7	AFDB:Q6NW64	0.521	0.606	5.534E-26	363	0.468	0.551	Q6NW64.pdb.gz
8	AFDB:A8WGR7	0.551	0.704	2.922E-23	328	0.464	0.604	A8WGR7.pdb.gz
9	PDB:5glhA	0.636	0.602	8.451E-23	452	0.452	0.427	5glhA.pdb.gz	Activation mechanism of endothelin ETB receptor by endothelin-1.
10	AFDB:P21729	0.673	0.743	3.721E-18	384	0.276	0.307	P21729.pdb.gz	GRPR_MOUSE Gastrin-releasing peptide receptor OS=Mus musculus OX=10090 GN=Grpr PE=1 SV=2
11	AFDB:O54799	0.640	0.697	3.738E-17	390	0.253	0.277	O54799.pdb.gz	NMBR_MOUSE Neuromedin-B receptor OS=Mus musculus OX=10090 GN=Nmbr PE=1 SV=1
12	PDB:7mbyR	0.543	0.792	2.632E-12	283	0.178	0.269	7mbyR.pdb.gz	Structures of the human cholecystokinin 1 (CCK1) receptor bound to Gs and Gq mimetic proteins provide insight into mechanisms of G protein selectivity.
13	PDB:7ezmD	0.556	0.755	6.020E-12	304	0.180	0.253	7ezmD.pdb.gz	Ligand recognition and G-protein coupling selectivity of cholecystokinin A receptor
14	PDB:8ef5M	0.581	0.836	6.020E-12	288	0.185	0.274	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.
15	PDB:7sqoR	0.520	0.783	1.377E-11	270	0.169	0.267	7sqoR.pdb.gz	Molecular mechanism of the wake-promoting agent TAK-925.
16	PDB:7x9bR	0.609	0.840	1.377E-11	302	0.159	0.225	7x9bR.pdb.gz
17	PDB:7wq3R	0.572	0.822	1.867E-11	289	0.162	0.239	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
18	PDB:6osaR	0.614	0.798	2.886E-11	321	0.166	0.221	6osaR.pdb.gz	Conformational transitions of a neurotensin receptor 1-Gi1complex.
19	PDB:7f8xA	0.562	0.543	2.886E-11	443	0.180	0.174	7f8xA.pdb.gz	Structures of the human cholecystokinin receptors bound to agonists and antagonists.
20	PDB:7wicR	0.544	0.775	3.288E-11	288	0.157	0.233	7wicR.pdb.gz	Structures of the endogenous peptide- and selective non-peptide agonist-bound SSTR2 signaling complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3DLG5	0.0	548	422	0.611	0.618	B3DLG5_DANRE Endothelin-1 receptor OS=Danio rerio OX=7955 GN=ednra PE=2 SV=1
2	P25101	0.0	887	427	1.000	1.000	EDNRA_HUMAN Endothelin-1 receptor OS=Homo sapiens OX=9606 GN=EDNRA PE=1 SV=1
3	P26684	0.0	805	426	0.927	0.930	EDNRA_RAT Endothelin-1 receptor OS=Rattus norvegicus OX=10116 GN=Ednra PE=2 SV=2
4	Q61614	0.0	810	427	0.923	0.923	EDNRA_MOUSE Endothelin-1 receptor OS=Mus musculus OX=10090 GN=Ednra PE=2 SV=3
5	Q9DGM2	4.16e-169	483	426	0.522	0.523	Q9DGM2_DANRE Endothelin receptor type B OS=Danio rerio OX=7955 GN=ednrb1 PE=2 SV=1
6	P21451	1.24e-166	477	442	0.529	0.511	EDNRB_RAT Endothelin receptor type B OS=Rattus norvegicus OX=10116 GN=Ednrb PE=2 SV=2
7	P24530	4.03e-166	476	442	0.536	0.518	EDNRB_HUMAN Endothelin receptor type B OS=Homo sapiens OX=9606 GN=EDNRB PE=1 SV=1
8	P48302	1.17e-165	474	442	0.543	0.525	EDNRB_MOUSE Endothelin receptor type B OS=Mus musculus OX=10090 GN=Ednrb PE=2 SV=1
9	P24053	1.53e-46	166	390	0.279	0.305	NMBR_RAT Neuromedin-B receptor OS=Rattus norvegicus OX=10116 GN=Nmbr PE=2 SV=1
10	O54799	6.57e-46	165	390	0.274	0.300	NMBR_MOUSE Neuromedin-B receptor OS=Mus musculus OX=10090 GN=Nmbr PE=1 SV=1
11	P28336	3.55e-44	160	390	0.248	0.272	NMBR_HUMAN Neuromedin-B receptor OS=Homo sapiens OX=9606 GN=NMBR PE=1 SV=2
12	P21729	5.63e-44	159	384	0.237	0.263	GRPR_MOUSE Gastrin-releasing peptide receptor OS=Mus musculus OX=10090 GN=Grpr PE=1 SV=2
13	P52500	3.21e-43	157	384	0.234	0.260	GRPR_RAT Gastrin-releasing peptide receptor OS=Rattus norvegicus OX=10116 GN=Grpr PE=1 SV=2
14	Q8K418	6.49e-40	149	399	0.241	0.258	BRS3_RAT Bombesin receptor subtype-3 OS=Rattus norvegicus OX=10116 GN=Brs3 PE=2 SV=1
15	P32247	4.93e-38	144	399	0.232	0.248	BRS3_HUMAN Bombesin receptor subtype-3 OS=Homo sapiens OX=9606 GN=BRS3 PE=1 SV=1
16	P30550	8.38e-38	143	384	0.218	0.242	GRPR_HUMAN Gastrin-releasing peptide receptor OS=Homo sapiens OX=9606 GN=GRPR PE=1 SV=1
17	X5D7H2	8.38e-38	143	384	0.218	0.242	X5D7H2_HUMAN Gastrin-releasing peptide receptor isoform A (Fragment) OS=Homo sapiens OX=9606 GN=GRPR PE=2 SV=1
18	A1ZAX0	6.00e-35	137	499	0.232	0.198	CCH1R_DROME Neuropeptide CCHamide-1 receptor OS=Drosophila melanogaster OX=7227 GN=CCHa1-R PE=2 SV=2
19	Q7SZP9	2.42e-30	122	362	0.215	0.254	APJA_DANRE Apelin receptor A OS=Danio rerio OX=7955 GN=aplnra PE=1 SV=2
20	Q4V622	7.32e-28	117	489	0.234	0.204	CCH2R_DROME Neuropeptide CCHamide-2 receptor OS=Drosophila melanogaster OX=7227 GN=CCHa2-R PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	2.1e-31	120.8	7 transmembrane receptor (rhodopsin family)
2	PF10320 7TM_GPCR_Srsx	0.56	21.1	Serpentine type 7TM GPCR chemoreceptor Srsx

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315011

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337128	0.999	Endothelin-3
2	9606.ENSP00000368683	0.999	Endothelin-1
3	9606.ENSP00000361668	0.996	Endothelin-2
4	9606.ENSP00000286548	0.946	Guanine nucleotide-binding protein G(q) subunit alpha
5	9606.ENSP00000078429	0.938	Guanine nucleotide-binding protein subunit alpha-11
6	9606.ENSP00000451828	0.937	RAC-alpha serine/threonine-protein kinase
7	9606.ENSP00000275493	0.936	Epidermal growth factor receptor
8	9606.ENSP00000400175	0.932	Transforming protein RhoA
9	9606.ENSP00000409581	0.932	Beta-arrestin-1
10	9606.ENSP00000443631	0.932	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
11	9606.ENSP00000338185	0.925	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
12	9606.ENSP00000265171	0.924	Pro-epidermal growth factor
13	9606.ENSP00000360141	0.919	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
14	9606.ENSP00000262958	0.918	Guanine nucleotide-binding protein subunit alpha-15
15	9606.ENSP00000275364	0.917	Guanine nucleotide-binding protein subunit alpha-12
16	9606.ENSP00000365807	0.917	Guanine nucleotide-binding protein subunit alpha-14
17	9606.ENSP00000334051	0.914	Guanine nucleotide-binding protein G(olf) subunit alpha
18	9606.ENSP00000263980	0.913	Sodium/hydrogen exchanger 1
19	9606.ENSP00000371067	0.910	Tyrosine-protein kinase JAK2
20	9606.ENSP00000378187	0.909	Adenylate cyclase type 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008528	1.000	G protein-coupled peptide receptor activity
GO:0005515	0.995	protein binding
GO:0003824	0.570	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.996	cellular process
GO:0050789	0.996	regulation of biological process
GO:0007154	0.994	cell communication
GO:0050794	0.992	regulation of cellular process
GO:0023052	0.986	signaling
GO:0032501	0.982	multicellular organismal process
GO:0007165	0.977	signal transduction
GO:0032502	0.970	developmental process
GO:0032879	0.947	regulation of localization
GO:0051049	0.940	regulation of transport
GO:0048518	0.939	positive regulation of biological process
GO:0008015	0.927	blood circulation
GO:0007186	0.896	G protein-coupled receptor signaling pathway
GO:0065008	0.882	regulation of biological quality
GO:0003018	0.880	vascular process in circulatory system
GO:0097746	0.855	blood vessel diameter maintenance
GO:0034765	0.851	regulation of monoatomic ion transmembrane transport
GO:0048522	0.838	positive regulation of cellular process
GO:0042310	0.793	vasoconstriction
GO:0035556	0.787	intracellular signal transduction
GO:0048856	0.773	anatomical structure development
GO:1904062	0.765	regulation of monoatomic cation transmembrane transport
GO:0048878	0.735	chemical homeostasis
GO:0019222	0.700	regulation of metabolic process
GO:0051050	0.676	positive regulation of transport
GO:0007204	0.670	positive regulation of cytosolic calcium ion concentration
GO:0065009	0.667	regulation of molecular function
GO:0003012	0.657	muscle system process
GO:0042221	0.651	response to chemical
GO:0050801	0.595	monoatomic ion homeostasis
GO:0051239	0.572	regulation of multicellular organismal process
GO:0060255	0.569	regulation of macromolecule metabolic process
GO:0051171	0.540	regulation of nitrogen compound metabolic process
GO:0048519	0.538	negative regulation of biological process
GO:0080090	0.518	regulation of primary metabolic process
GO:0043270	0.508	positive regulation of monoatomic ion transport
GO:0071704	0.498	organic substance metabolic process
GO:0048583	0.487	regulation of response to stimulus
GO:0070887	0.486	cellular response to chemical stimulus
GO:0010033	0.480	response to organic substance
GO:0003014	0.470	renal system process
GO:0044237	0.469	cellular metabolic process
GO:0007275	0.468	multicellular organism development
GO:0031323	0.466	regulation of cellular metabolic process
GO:0023051	0.465	regulation of signaling
GO:0009966	0.459	regulation of signal transduction
GO:0048523	0.455	negative regulation of cellular process
GO:0009893	0.455	positive regulation of metabolic process
GO:0006807	0.423	nitrogen compound metabolic process
GO:0010604	0.388	positive regulation of macromolecule metabolic process
GO:0051246	0.330	regulation of protein metabolic process
GO:0048584	0.325	positive regulation of response to stimulus
GO:0007166	0.325	cell surface receptor signaling pathway
GO:1902531	0.314	regulation of intracellular signal transduction
GO:0051179	0.307	localization
GO:0010468	0.300	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.892	intracellular anatomical structure
GO:0043231	0.820	intracellular membrane-bounded organelle
GO:0005737	0.465	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]