StarFunc result for job id P25116

User Input

>input (425 residues)
MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE
KNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLN
IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA
AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLK
EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVS
SISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
KKLLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P25116	1.000	1.000	5.723E-55	425	1.000	1.000	P25116.pdb.gz	PAR1_HUMAN Proteinase-activated receptor 1 OS=Homo sapiens OX=9606 GN=F2R PE=1 SV=2
2	AFDB:P26824	0.806	0.793	2.774E-44	432	0.786	0.773	P26824.pdb.gz	PAR1_RAT Proteinase-activated receptor 1 OS=Rattus norvegicus OX=10116 GN=F2r PE=2 SV=1
3	AFDB:A2BIP6	0.720	0.740	2.552E-28	413	0.414	0.426	A2BIP6.pdb.gz	A2BIP6_DANRE Proteinase-activated receptor 1 OS=Danio rerio OX=7955 GN=PAR1 PE=2 SV=1
4	PDB:3vw7A	0.633	0.609	5.145E-27	442	0.659	0.633	3vw7A.pdb.gz	High-resolution crystal structure of human protease-activated receptor 1
5	AFDB:P55086	0.684	0.726	4.428E-20	399	0.313	0.333	P55086.pdb.gz	PAR2_MOUSE Proteinase-activated receptor 2 OS=Mus musculus OX=10090 GN=F2rl1 PE=1 SV=1
6	AFDB:P55085	0.737	0.786	7.679E-20	397	0.315	0.338	P55085.pdb.gz	PAR2_HUMAN Proteinase-activated receptor 2 OS=Homo sapiens OX=9606 GN=F2RL1 PE=1 SV=1
7	AFDB:F1S2H4	0.667	0.713	1.078E-19	397	0.320	0.343	F1S2H4.pdb.gz	F1S2H4_PIG F2R like trypsin receptor 1 OS=Sus scrofa OX=9823 GN=F2RL1 PE=4 SV=1
8	AFDB:O88634	0.678	0.726	1.276E-19	396	0.278	0.298	O88634.pdb.gz	PAR4_MOUSE Proteinase-activated receptor 4 OS=Mus musculus OX=10090 GN=F2rl3 PE=1 SV=2
9	AFDB:O00254	0.650	0.735	1.717E-19	374	0.275	0.313	O00254.pdb.gz	PAR3_HUMAN Proteinase-activated receptor 3 OS=Homo sapiens OX=9606 GN=F2RL2 PE=1 SV=1
10	AFDB:I3IRY7	0.674	0.732	2.409E-19	390	0.292	0.318	I3IRY7.pdb.gz	I3IRY7_DANRE Coagulation factor II (Thrombin) receptor-like 1 isoform X1 OS=Danio rerio OX=7955 GN=PAR2b PE=4 SV=1
11	AFDB:O08675	0.658	0.754	4.178E-19	369	0.261	0.301	O08675.pdb.gz	PAR3_MOUSE Proteinase-activated receptor 3 OS=Mus musculus OX=10090 GN=F2rl2 PE=1 SV=2
12	PDB:5nddA	0.647	0.489	6.231E-15	567	0.280	0.210	5nddA.pdb.gz	Structural insight into allosteric modulation of protease-activated receptor 2.
13	PDB:7vl9R	0.623	0.859	1.314E-13	302	0.184	0.258	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
14	PDB:7x9yR	0.592	0.838	5.546E-13	293	0.165	0.239	7x9yR.pdb.gz
15	PDB:8ef5M	0.582	0.833	1.740E-12	288	0.188	0.278	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.
16	PDB:7f1qR	0.594	0.682	2.341E-12	367	0.162	0.188	7f1qR.pdb.gz
17	PDB:5xszA	0.556	0.529	3.426E-12	448	0.202	0.192	5xszA.pdb.gz
18	PDB:7wicR	0.585	0.840	3.891E-12	288	0.179	0.264	7wicR.pdb.gz	Structures of the endogenous peptide- and selective non-peptide agonist-bound SSTR2 signaling complexes.
19	PDB:7f6hA	0.610	0.831	1.329E-11	305	0.191	0.266	7f6hA.pdb.gz	Cryo-EM structures of human bradykinin receptor-G q proteins complexes.
20	PDB:7wq4R	0.569	0.831	1.509E-11	282	0.169	0.255	7wq4R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P25116	0.0	862	425	1.000	1.000	PAR1_HUMAN Proteinase-activated receptor 1 OS=Homo sapiens OX=9606 GN=F2R PE=1 SV=2
2	P26824	0.0	664	432	0.786	0.773	PAR1_RAT Proteinase-activated receptor 1 OS=Rattus norvegicus OX=10116 GN=F2r PE=2 SV=1
3	P30558	0.0	645	430	0.791	0.781	PAR1_MOUSE Proteinase-activated receptor 1 OS=Mus musculus OX=10090 GN=F2r PE=1 SV=2
4	A2BIP6	3.30e-119	355	413	0.419	0.431	A2BIP6_DANRE Proteinase-activated receptor 1 OS=Danio rerio OX=7955 GN=PAR1 PE=2 SV=1
5	Q63645	2.75e-71	231	397	0.304	0.325	PAR2_RAT Proteinase-activated receptor 2 OS=Rattus norvegicus OX=10116 GN=F2rl1 PE=1 SV=1
6	P55086	5.82e-71	231	399	0.301	0.321	PAR2_MOUSE Proteinase-activated receptor 2 OS=Mus musculus OX=10090 GN=F2rl1 PE=1 SV=1
7	P55085	6.65e-70	228	397	0.296	0.317	PAR2_HUMAN Proteinase-activated receptor 2 OS=Homo sapiens OX=9606 GN=F2RL1 PE=1 SV=1
8	F1S2H4	1.15e-68	224	397	0.292	0.312	F1S2H4_PIG F2R like trypsin receptor 1 OS=Sus scrofa OX=9823 GN=F2RL1 PE=4 SV=1
9	I3IRY7	2.24e-66	218	390	0.282	0.308	I3IRY7_DANRE Coagulation factor II (Thrombin) receptor-like 1 isoform X1 OS=Danio rerio OX=7955 GN=PAR2b PE=4 SV=1
10	A5PLC2	1.95e-64	213	389	0.282	0.308	A5PLC2_DANRE Coagulation factor II (Thrombin) receptor-like 1 precursor OS=Danio rerio OX=7955 GN=PAR2b PE=2 SV=1
11	Q920E1	9.75e-56	190	368	0.280	0.323	PAR3_RAT Proteinase-activated receptor 3 OS=Rattus norvegicus OX=10116 GN=F2rl2 PE=2 SV=1
12	O00254	4.53e-52	181	374	0.266	0.302	PAR3_HUMAN Proteinase-activated receptor 3 OS=Homo sapiens OX=9606 GN=F2RL2 PE=1 SV=1
13	O08675	8.81e-50	174	369	0.268	0.309	PAR3_MOUSE Proteinase-activated receptor 3 OS=Mus musculus OX=10090 GN=F2rl2 PE=1 SV=2
14	O88634	7.98e-49	172	396	0.259	0.278	PAR4_MOUSE Proteinase-activated receptor 4 OS=Mus musculus OX=10090 GN=F2rl3 PE=1 SV=2
15	Q8BMC0	1.07e-46	166	344	0.226	0.279	LPAR6_MOUSE Lysophosphatidic acid receptor 6 OS=Mus musculus OX=10090 GN=Lpar6 PE=1 SV=1
16	P43657	4.49e-46	164	344	0.226	0.279	LPAR6_HUMAN Lysophosphatidic acid receptor 6 OS=Homo sapiens OX=9606 GN=LPAR6 PE=1 SV=3
17	Q920E0	6.79e-46	165	395	0.268	0.289	PAR4_RAT Proteinase-activated receptor 4 OS=Rattus norvegicus OX=10116 GN=F2rl3 PE=2 SV=1
18	Q13304	1.16e-45	163	367	0.233	0.270	GPR17_HUMAN Uracil nucleotide/cysteinyl leukotriene receptor OS=Homo sapiens OX=9606 GN=GPR17 PE=1 SV=2
19	Q09QM4	1.95e-44	159	339	0.226	0.283	GPR17_RAT Uracil nucleotide/cysteinyl leukotriene receptor OS=Rattus norvegicus OX=10116 GN=Gpr17 PE=2 SV=1
20	Q6NS65	3.05e-44	159	339	0.224	0.280	GPR17_MOUSE Uracil nucleotide/cysteinyl leukotriene receptor OS=Mus musculus OX=10090 GN=Gpr17 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	2e-40	150.4	7 transmembrane receptor (rhodopsin family)
2	PF13273 DUF4064	6.8e+02	12.0	Protein of unknown function (DUF4064)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321326

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308541	0.998	Prothrombin
2	9606.ENSP00000286548	0.993	Guanine nucleotide-binding protein G(q) subunit alpha
3	9606.ENSP00000216968	0.977	Endothelial protein C receptor
4	9606.ENSP00000400717	0.975	Guanine nucleotide-binding protein subunit alpha-13
5	9606.ENSP00000261889	0.974	Sorting nexin-1
6	9606.ENSP00000275364	0.970	Guanine nucleotide-binding protein subunit alpha-12
7	9606.ENSP00000409581	0.967	Beta-arrestin-1
8	9606.ENSP00000234071	0.952	Vitamin K-dependent protein C
9	9606.ENSP00000262494	0.949	Guanine nucleotide-binding protein G(o) subunit alpha
10	9606.ENSP00000312999	0.944	Guanine nucleotide-binding protein G(i) subunit alpha-2
11	9606.ENSP00000181383	0.943	Carboxypeptidase B2
12	9606.ENSP00000296641	0.942	Proteinase-activated receptor 3
13	9606.ENSP00000377783	0.935	Vitamin K-dependent protein S
14	9606.ENSP00000262958	0.930	Guanine nucleotide-binding protein subunit alpha-15
15	9606.ENSP00000317578	0.917	Beta-adrenergic receptor kinase 2
16	9606.ENSP00000478892	0.917	Guanine nucleotide-binding protein G(z) subunit alpha
17	9606.ENSP00000338185	0.916	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
18	9606.ENSP00000248076	0.915	Proteinase-activated receptor 4
19	9606.ENSP00000078429	0.914	Guanine nucleotide-binding protein subunit alpha-11
20	9606.ENSP00000407586	0.911	GTPase HRas

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004930	1.000	G protein-coupled receptor activity
GO:0005515	0.995	protein binding
GO:0008528	0.988	G protein-coupled peptide receptor activity
GO:0005102	0.478	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.989	response to stimulus
GO:0065008	0.989	regulation of biological quality
GO:0050789	0.988	regulation of biological process
GO:0032501	0.985	multicellular organismal process
GO:0009987	0.985	cellular process
GO:0007165	0.977	signal transduction
GO:0050878	0.968	regulation of body fluid levels
GO:0007186	0.965	G protein-coupled receptor signaling pathway
GO:0050817	0.921	coagulation
GO:0048518	0.908	positive regulation of biological process
GO:0007599	0.899	hemostasis
GO:0042060	0.891	wound healing
GO:0048522	0.885	positive regulation of cellular process
GO:1902533	0.883	positive regulation of intracellular signal transduction
GO:0007596	0.854	blood coagulation
GO:0048519	0.805	negative regulation of biological process
GO:0051049	0.790	regulation of transport
GO:0051239	0.715	regulation of multicellular organismal process
GO:0051240	0.638	positive regulation of multicellular organismal process
GO:0003008	0.558	system process
GO:0019222	0.547	regulation of metabolic process
GO:0060255	0.520	regulation of macromolecule metabolic process
GO:0048523	0.482	negative regulation of cellular process
GO:0032101	0.463	regulation of response to external stimulus
GO:0065009	0.449	regulation of molecular function
GO:0080134	0.425	regulation of response to stress
GO:0043410	0.412	positive regulation of MAPK cascade
GO:0042221	0.399	response to chemical
GO:0080090	0.369	regulation of primary metabolic process
GO:0048856	0.367	anatomical structure development
GO:0051171	0.367	regulation of nitrogen compound metabolic process
GO:0061041	0.355	regulation of wound healing
GO:1900046	0.349	regulation of hemostasis
GO:0050818	0.342	regulation of coagulation
GO:0030193	0.331	regulation of blood coagulation
GO:0051050	0.324	positive regulation of transport
GO:0031323	0.318	regulation of cellular metabolic process
GO:0009893	0.311	positive regulation of metabolic process
GO:0071840	0.305	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.978	intracellular anatomical structure
GO:0043227	0.975	membrane-bounded organelle
GO:0005737	0.937	cytoplasm
GO:0012505	0.924	endomembrane system
GO:0031982	0.911	vesicle
GO:0043229	0.882	intracellular organelle
GO:0043231	0.871	intracellular membrane-bounded organelle
GO:0005576	0.833	extracellular region
GO:0005615	0.803	extracellular space
GO:0031410	0.722	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]