StarFunc result for job id P25208

User Input

>input (207 residues)
MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLP
IANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILF
AMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLIT
TDGQQQNVMVYTTSYQQISGVQQIQFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F8VSL3	0.701	0.698	5.273E-29	208	0.990	0.986	F8VSL3.pdb.gz	F8VSL3_HUMAN Nuclear transcription factor Y subunit beta OS=Homo sapiens OX=9606 GN=NFYB PE=1 SV=2
2	AFDB:Q75IZ7	0.457	0.433	6.617E-13	219	0.396	0.374	Q75IZ7.pdb.gz	NFYB8_ORYSJ Nuclear transcription factor Y subunit B-8 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYB8 PE=1 SV=1
3	AFDB:Q84W66	0.491	0.436	1.090E-12	234	0.372	0.329	Q84W66.pdb.gz	NFYB6_ARATH Nuclear transcription factor Y subunit B-6 OS=Arabidopsis thaliana OX=3702 GN=NFYB6 PE=1 SV=2
4	AFDB:Q8VYK4	0.484	0.570	1.235E-12	173	0.391	0.468	Q8VYK4.pdb.gz	NFYB8_ARATH Nuclear transcription factor Y subunit B-8 OS=Arabidopsis thaliana OX=3702 GN=NFYB8 PE=1 SV=1
5	AFDB:Q5B5Z6	0.483	0.458	1.489E-12	219	0.401	0.379	Q5B5Z6.pdb.gz	Q5B5Z6_EMENI Transcription factor HapC (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04034 PE=1 SV=1
6	AFDB:Q69J40	0.449	0.416	2.305E-12	224	0.377	0.348	Q69J40.pdb.gz	NFYBA_ORYSJ Nuclear transcription factor Y subunit B-10 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYB10 PE=1 SV=1
7	AFDB:Q9SFD8	0.498	0.434	2.305E-12	238	0.357	0.311	Q9SFD8.pdb.gz	NFYB9_ARATH Nuclear transcription factor Y subunit B-9 OS=Arabidopsis thaliana OX=3702 GN=NFYB9 PE=1 SV=2
8	AFDB:Q9SLG0	0.508	0.733	2.305E-12	141	0.367	0.539	Q9SLG0.pdb.gz	NFYB1_ARATH Nuclear transcription factor Y subunit B-1 OS=Arabidopsis thaliana OX=3702 GN=NFYB1 PE=1 SV=2
9	AFDB:Q9FGJ3	0.476	0.518	2.612E-12	190	0.396	0.432	Q9FGJ3.pdb.gz	NFYB2_ARATH Nuclear transcription factor Y subunit B-2 OS=Arabidopsis thaliana OX=3702 GN=NFYB2 PE=1 SV=1
10	AFDB:Q5QMG3	0.520	0.602	3.149E-12	178	0.367	0.427	Q5QMG3.pdb.gz	NFYB2_ORYSJ Nuclear transcription factor Y subunit B-2 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYB2 PE=1 SV=1
11	PDB:1jfiB	0.422	0.638	2.170E-6	135	0.169	0.259	1jfiB.pdb.gz	Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
12	PDB:5y27A	0.440	0.913	2.785E-6	98	0.116	0.245	5y27A.pdb.gz
13	PDB:2bykD	0.403	0.863	2.803E-5	92	0.140	0.315	2bykD.pdb.gz
14	PDB:6wjv4	0.385	0.689	3.002E-4	107	0.111	0.215	6wjv4.pdb.gz
15	PDB:7pj1B	0.324	0.513	6.757E-4	122	0.116	0.197	7pj1B.pdb.gz
16	PDB:2rvqD	0.321	0.476	8.148E-4	129	0.111	0.178	2rvqD.pdb.gz
17	PDB:1b67A	0.303	0.877	2.354E-3	68	0.116	0.353	1b67A.pdb.gz
18	PDB:1bfmA	0.295	0.812	2.839E-3	69	0.111	0.333	1bfmA.pdb.gz
19	PDB:6gejG	0.315	0.614	4.677E-3	96	0.087	0.188	6gejG.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
20	PDB:5z30G	0.304	0.527	5.298E-3	110	0.072	0.136	5z30G.pdb.gz	Cancer-associated mutations of histones H2B, H3.1 and H2A.Z.1 affect the structure and stability of the nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P25208	4.37e-155	429	207	1.000	1.000	NFYB_HUMAN Nuclear transcription factor Y subunit beta OS=Homo sapiens OX=9606 GN=NFYB PE=1 SV=2
2	P63139	5.70e-154	426	207	0.990	0.990	NFYB_MOUSE Nuclear transcription factor Y subunit beta OS=Mus musculus OX=10090 GN=Nfyb PE=1 SV=1
3	P63140	5.70e-154	426	207	0.990	0.990	NFYB_RAT Nuclear transcription factor Y subunit beta OS=Rattus norvegicus OX=10116 GN=Nfyb PE=1 SV=1
4	F8VSL3	1.57e-153	425	208	0.990	0.986	F8VSL3_HUMAN Nuclear transcription factor Y subunit beta OS=Homo sapiens OX=9606 GN=NFYB PE=1 SV=2
5	O23310	2.91e-49	159	161	0.367	0.472	NFYB3_ARATH Nuclear transcription factor Y subunit B-3 OS=Arabidopsis thaliana OX=3702 GN=NFYB3 PE=1 SV=1
6	Q9SLG0	1.83e-48	157	141	0.333	0.489	NFYB1_ARATH Nuclear transcription factor Y subunit B-1 OS=Arabidopsis thaliana OX=3702 GN=NFYB1 PE=1 SV=2
7	Q5QMG3	3.40e-48	157	178	0.338	0.393	NFYB2_ORYSJ Nuclear transcription factor Y subunit B-2 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYB2 PE=1 SV=1
8	Q69J40	5.92e-48	158	224	0.353	0.326	NFYBA_ORYSJ Nuclear transcription factor Y subunit B-10 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYB10 PE=1 SV=1
9	Q5A6N7	9.63e-48	154	105	0.338	0.667	Q5A6N7_CANAL Hap31p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HAP31 PE=3 SV=1
10	Q5B5Z6	2.05e-47	157	219	0.333	0.315	Q5B5Z6_EMENI Transcription factor HapC (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04034 PE=1 SV=1
11	Q2UK39	2.53e-47	156	215	0.333	0.321	Q2UK39_ASPOR Transcription factor CBF/NF-Y/archaeal histone domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000963 PE=3 SV=1
12	F4ITZ0	3.05e-47	154	164	0.329	0.415	F4ITZ0_ARATH Nuclear factor Y, subunit B1 OS=Arabidopsis thaliana OX=3702 GN=NF-YB1 PE=1 SV=1
13	Q9FGJ3	1.43e-46	154	190	0.343	0.374	NFYB2_ARATH Nuclear transcription factor Y subunit B-2 OS=Arabidopsis thaliana OX=3702 GN=NFYB2 PE=1 SV=1
14	Q8VYK4	1.60e-46	153	173	0.372	0.445	NFYB8_ARATH Nuclear transcription factor Y subunit B-8 OS=Arabidopsis thaliana OX=3702 GN=NFYB8 PE=1 SV=1
15	Q75IZ7	2.09e-46	154	219	0.362	0.342	NFYB8_ORYSJ Nuclear transcription factor Y subunit B-8 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYB8 PE=1 SV=1
16	Q67XJ2	3.99e-46	152	176	0.343	0.403	NFYBA_ARATH Nuclear transcription factor Y subunit B-10 OS=Arabidopsis thaliana OX=3702 GN=NFYB10 PE=1 SV=1
17	Q8ST61	1.46e-44	147	156	0.309	0.410	Q8ST61_DROME Nuclear factor Y-box B, isoform A OS=Drosophila melanogaster OX=7227 GN=Nf-YB PE=1 SV=1
18	Q84W66	3.42e-44	149	234	0.357	0.316	NFYB6_ARATH Nuclear transcription factor Y subunit B-6 OS=Arabidopsis thaliana OX=3702 GN=NFYB6 PE=1 SV=2
19	P13434	3.87e-43	143	144	0.333	0.479	HAP3_YEAST Transcriptional activator HAP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HAP3 PE=1 SV=1
20	Q9SIT9	3.93e-42	143	215	0.314	0.302	NFYB7_ARATH Nuclear transcription factor Y subunit B-7 OS=Arabidopsis thaliana OX=3702 GN=NFYB7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05511 ATP-synt_F6	4.3e+02	12.7	Mitochondrial ATP synthase coupling factor 6
2	PF00808 CBFD_NFYB_HMF	7e-25	98.4	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
3	PF15511 CENP-T_C	7.8	18.0	Centromere kinetochore component CENP-T histone fold
4	PF00125 Histone	0.0042	28.8	Core histone H2A/H2B/H3/H4
5	PF08277 PAN_3	4e+02	12.2	PAN-like domain
6	PF02269 TFIID-18kDa	5	18.5	Transcription initiation factor IID, 18kD subunit
7	PF03847 TFIID_20kDa	4.4e+02	12.8	Transcription initiation factor TFIID subunit A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000007959

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000006102	0.999	Nuclear transcription factor Y, alpha
2	61853.ENSNLEP00000014823	0.998	Nuclear transcription factor Y subunit gamma
3	61853.ENSNLEP00000022464	0.973	Chromatin accessibility complex 1
4	61853.ENSNLEP00000012367	0.904	Class II, major histocompatibility complex, transactivator
5	61853.ENSNLEP00000013029	0.887	Inhibitor of growth family, member 2
6	61853.ENSNLEP00000001299	0.876	Polymerase (DNA-directed), epsilon 4, accessory subunit
7	61853.ENSNLEP00000002048	0.823	Bromodomain PHD finger transcription factor
8	61853.ENSNLEP00000011861	0.798	Cellular tumor antigen p53
9	61853.ENSNLEP00000018748	0.797	E1A binding protein p300
10	61853.ENSNLEP00000007617	0.782	pre-mRNA processing factor 31
11	61853.ENSNLEP00000010540	0.782	PITH (C-terminal proteasome-interacting domain of thioredoxin-like) domain containing 1
12	61853.ENSNLEP00000009458	0.777	GTP cyclohydrolase I feedback regulator
13	61853.ENSNLEP00000019473	0.753	F-box and leucine-rich repeat protein 19
14	61853.ENSNLEP00000003625	0.738	Kinesin-like protein
15	61853.ENSNLEP00000017173	0.738	Kinesin-like protein
16	61853.ENSNLEP00000014189	0.737	ARP1 actin-related protein 1 homolog B, centractin beta (yeast)
17	61853.ENSNLEP00000018415	0.737	ARP1 actin-related protein 1 homolog A, centractin alpha (yeast)
18	61853.ENSNLEP00000007197	0.733	DR1-associated protein 1 (negative cofactor 2 alpha)
19	61853.ENSNLEP00000004591	0.723	Replication initiator 1
20	61853.ENSNLEP00000006740	0.717	MYC proto-oncogene, bHLH transcription factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0003700	0.999	DNA-binding transcription factor activity
GO:0044877	0.796	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0080090	0.986	regulation of primary metabolic process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0031323	0.986	regulation of cellular metabolic process
GO:0008152	0.985	metabolic process
GO:0071704	0.984	organic substance metabolic process
GO:0044238	0.982	primary metabolic process
GO:0045893	0.978	positive regulation of DNA-templated transcription
GO:0006807	0.974	nitrogen compound metabolic process
GO:0044237	0.970	cellular metabolic process
GO:0043170	0.964	macromolecule metabolic process
GO:0016570	0.903	histone modification
GO:0018205	0.896	peptidyl-lysine modification
GO:1901360	0.875	organic cyclic compound metabolic process
GO:0006351	0.871	DNA-templated transcription
GO:0031056	0.859	regulation of histone modification
GO:0006366	0.846	transcription by RNA polymerase II
GO:0050896	0.792	response to stimulus
GO:1901983	0.786	regulation of protein acetylation
GO:0043414	0.764	macromolecule methylation
GO:0045944	0.756	positive regulation of transcription by RNA polymerase II
GO:0051568	0.728	histone H3-K4 methylation
GO:0051716	0.706	cellular response to stimulus
GO:0070887	0.703	cellular response to chemical stimulus
GO:0018023	0.681	peptidyl-lysine trimethylation
GO:0034097	0.680	response to cytokine
GO:1990823	0.674	response to leukemia inhibitory factor
GO:0071310	0.374	cellular response to organic substance
GO:0071345	0.353	cellular response to cytokine stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.990	protein-containing complex
GO:0140513	0.766	nuclear protein-containing complex
GO:0005667	0.639	transcription regulator complex
GO:0090575	0.496	RNA polymerase II transcription regulator complex
GO:0016602	0.323	CCAAT-binding factor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]