StarFunc result for job id P25311

User Input

>input (298 residues)
MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFR
YNSKDRKSQPMGLWRQVEGMEDWKQDSQLQKAREDIFMETLKDIVEYYNDSNGSHVLQGR
FGCEIENNRSSGAFWKYYYDGKDYIEFNKEIPAWVPFDPAAQITKQKWEAEPVYVQRAKA
YLEEECPATLRKYLKYSKNILDRQDPPSVVVTSHQAPGEKKKLKCLAYDFYPGKIDVHWT
RAGEVQEPELRGDVLHNGNGTYQSWVVVAVPPQDTAPYSCHVQHSSLAQPLVVPWEAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P25311	1.000	1.000	4.836E-62	298	1.000	1.000	P25311.pdb.gz	ZA2G_HUMAN Zinc-alpha-2-glycoprotein OS=Homo sapiens OX=9606 GN=AZGP1 PE=1 SV=2
2	PDB:3es6A	0.907	0.974	1.953E-53	277	0.930	1.000	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
3	AFDB:Q63678	0.859	0.864	4.941E-44	296	0.601	0.605	Q63678.pdb.gz	ZA2G_RAT Zinc-alpha-2-glycoprotein OS=Rattus norvegicus OX=10116 GN=Azgp1 PE=2 SV=1
4	AFDB:Q95460	0.738	0.657	5.467E-29	341	0.352	0.308	Q95460.pdb.gz	HMR1_HUMAN Major histocompatibility complex class I-related gene protein OS=Homo sapiens OX=9606 GN=MR1 PE=1 SV=1
5	AFDB:P01889	0.743	0.625	8.523E-29	362	0.379	0.312	P01889.pdb.gz	HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3
6	AFDB:P70387	0.801	0.674	9.010E-29	359	0.319	0.265	P70387.pdb.gz	HFE_MOUSE Hereditary hemochromatosis protein homolog OS=Mus musculus OX=10090 GN=Hfe PE=1 SV=2
7	AFDB:O35799	0.661	0.565	9.524E-29	360	0.332	0.275	O35799.pdb.gz	HFE_RAT Hereditary hemochromatosis protein homolog OS=Rattus norvegicus OX=10116 GN=Hfe PE=2 SV=1
8	AFDB:Q8HWB0	0.788	0.697	9.524E-29	341	0.339	0.296	Q8HWB0.pdb.gz	HMR1_MOUSE Major histocompatibility complex class I-related gene protein OS=Mus musculus OX=10090 GN=Mr1 PE=1 SV=2
9	AFDB:Q30201	0.811	0.703	1.485E-28	348	0.339	0.290	Q30201.pdb.gz	HFE_HUMAN Hereditary hemochromatosis protein OS=Homo sapiens OX=9606 GN=HFE PE=1 SV=1
10	AFDB:P10321	0.747	0.623	2.315E-28	366	0.366	0.298	P10321.pdb.gz	HLAC_HUMAN HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=3
11	AFDB:P01900	0.765	0.637	3.230E-28	365	0.369	0.301	P01900.pdb.gz	HA12_MOUSE H-2 class I histocompatibility antigen, D-D alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
12	PDB:5j6hA	0.734	0.787	2.590E-26	275	0.332	0.360	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
13	PDB:6e1iA	0.701	0.557	2.590E-26	389	0.326	0.249	6e1iA.pdb.gz
14	PDB:6d7gA	0.698	0.559	4.038E-26	386	0.339	0.262	6d7gA.pdb.gz
15	PDB:6fgbA	0.784	0.875	5.647E-24	265	0.238	0.268	6fgbA.pdb.gz
16	PDB:2qriA	0.744	0.574	1.373E-23	398	0.339	0.254	2qriA.pdb.gz
17	PDB:6mp0A	0.683	0.545	1.451E-23	388	0.309	0.237	6mp0A.pdb.gz
18	PDB:3nwmA	0.709	0.567	4.166E-23	384	0.336	0.260	3nwmA.pdb.gz
19	PDB:1cd1A	0.738	0.798	1.107E-17	273	0.185	0.201	1cd1A.pdb.gz
20	PDB:3ov6A	0.707	0.575	6.189E-17	376	0.211	0.168	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P25311	0.0	622	298	1.000	1.000	ZA2G_HUMAN Zinc-alpha-2-glycoprotein OS=Homo sapiens OX=9606 GN=AZGP1 PE=1 SV=2
2	Q63678	1.14e-125	362	296	0.567	0.571	ZA2G_RAT Zinc-alpha-2-glycoprotein OS=Rattus norvegicus OX=10116 GN=Azgp1 PE=2 SV=1
3	P01889	4.53e-61	199	362	0.376	0.309	HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3
4	Q53YP1	9.66e-59	194	366	0.383	0.311	Q53YP1_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
5	Q5SUL5	1.81e-58	193	365	0.369	0.301	Q5SUL5_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=1
6	P01893	5.32e-58	192	362	0.366	0.301	HLAH_HUMAN Putative HLA class I histocompatibility antigen, alpha chain H OS=Homo sapiens OX=9606 GN=HLA-H PE=5 SV=3
7	P01900	2.04e-57	190	365	0.352	0.288	HA12_MOUSE H-2 class I histocompatibility antigen, D-D alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
8	P17693	4.22e-57	189	338	0.376	0.331	HLAG_HUMAN HLA class I histocompatibility antigen, alpha chain G OS=Homo sapiens OX=9606 GN=HLA-G PE=1 SV=1
9	F8W7W8	5.14e-57	188	337	0.342	0.303	F8W7W8_HUMAN Homeostatic iron regulator OS=Homo sapiens OX=9606 GN=HFE PE=1 SV=1
10	A0A583ZBW8	6.43e-57	189	366	0.383	0.311	A0A583ZBW8_HUMAN HLA-C protein OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
11	Q30201	7.92e-57	188	348	0.342	0.293	HFE_HUMAN Hereditary hemochromatosis protein OS=Homo sapiens OX=9606 GN=HFE PE=1 SV=1
12	P04439	1.31e-56	188	365	0.362	0.296	HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2
13	Q5RIP0	1.32e-56	188	366	0.379	0.309	Q5RIP0_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
14	P14429	2.51e-56	186	334	0.342	0.305	HA17_MOUSE H-2 class I histocompatibility antigen, Q7 alpha chain OS=Mus musculus OX=10090 GN=H2-Q7 PE=1 SV=1
15	P14432	3.61e-56	187	384	0.379	0.294	HA1T_MOUSE H-2 class I histocompatibility antigen, TLA(B) alpha chain OS=Mus musculus OX=10090 GN=H2-T3 PE=1 SV=2
16	A0A0G2K4S5	7.78e-55	183	356	0.339	0.284	A0A0G2K4S5_RAT RT1 class Ia, locus A2 OS=Rattus norvegicus OX=10116 GN=RT1-CE1 PE=3 SV=2
17	Q7YQB1	1.18e-54	183	366	0.352	0.287	Q7YQB1_HUMAN MHC class I antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
18	Q6B0J5	1.69e-54	182	345	0.332	0.287	Q6B0J5_HUMAN HFE protein OS=Homo sapiens OX=9606 GN=HFE PE=1 SV=1
19	A0A0G2K1E1	2.00e-54	182	352	0.342	0.290	A0A0G2K1E1_RAT RT1 class Ia, locus A1 OS=Rattus norvegicus OX=10116 GN=RT1-A1 PE=3 SV=2
20	P04223	2.09e-54	182	369	0.352	0.285	HA1K_MOUSE H-2 class I histocompatibility antigen, K-K alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	2e-09	49.0	Immunoglobulin C1-set domain
2	PF07679 I-set	2.4e+02	13.2	Immunoglobulin I-set domain
3	PF00047 ig	3.2	19.3	Immunoglobulin domain
4	PF13927 Ig_3	0.23	23.3	Immunoglobulin domain
5	PF00129 MHC_I	8.3e-66	232.5	Class I Histocompatibility antigen, domains alpha 1 and 2
6	PF00969 MHC_II_beta	3.5e+02	12.7	Class II histocompatibility antigen, beta domain
7	PF14586 MHC_I_2	71	14.7	Class I Histocompatibility antigen, NKG2D ligand, domains 1 and 2
8	PF16497 MHC_I_3	0.077	24.0	MHC-I family domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000292401

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000291009	0.995	Prolactin induced protein
2	9606.ENSP00000295897	0.886	Serum albumin
3	9606.ENSP00000216968	0.669	Endothelial protein C receptor
4	9606.ENSP00000442600	0.665	Dystroglycan
5	9606.ENSP00000482609	0.651	Peroxisome assembly protein 12
6	9606.ENSP00000363571	0.647	Muscle, skeletal receptor tyrosine-protein kinase
7	9606.ENSP00000450540	0.639	Alpha-1-antichymotrypsin
8	9606.ENSP00000261023	0.638	Integrin alpha-V
9	9606.ENSP00000348170	0.636	Haptoglobin
10	9606.ENSP00000286544	0.618	Protein FAM161B
11	9606.ENSP00000345179	0.603	Apolipoprotein D
12	9606.ENSP00000360522	0.599	Retinol-binding protein 4
13	9606.ENSP00000296805	0.593	Ribosome-releasing factor 2, mitochondrial
14	9606.ENSP00000343782	0.593	Beta-3 adrenergic receptor
15	9606.ENSP00000393887	0.590	Alpha-2-HS-glycoprotein
16	9606.ENSP00000416066	0.582	Alpha-1-antitrypsin
17	9606.ENSP00000421725	0.574	Vitamin D-binding protein
18	9606.ENSP00000217381	0.567	Alpha-1-syntrophin
19	9606.ENSP00000263100	0.567	Alpha-1B-glycoprotein
20	9606.ENSP00000385834	0.565	Serotransferrin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.913	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.985	response to stimulus
GO:0009987	0.981	cellular process
GO:0032501	0.920	multicellular organismal process
GO:0065007	0.904	biological regulation
GO:0050789	0.865	regulation of biological process
GO:0042221	0.852	response to chemical
GO:0001895	0.625	retina homeostasis
GO:0051606	0.618	detection of stimulus
GO:0007606	0.608	sensory perception of chemical stimulus
GO:0050794	0.575	regulation of cellular process
GO:0048518	0.557	positive regulation of biological process
GO:0050909	0.517	sensory perception of taste
GO:0009593	0.486	detection of chemical stimulus
GO:0050913	0.478	sensory perception of bitter taste
GO:0050907	0.477	detection of chemical stimulus involved in sensory perception
GO:0050912	0.451	detection of chemical stimulus involved in sensory perception of taste
GO:0048583	0.427	regulation of response to stimulus
GO:0048519	0.333	negative regulation of biological process
GO:0019222	0.333	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.998	cell periphery
GO:0005615	0.998	extracellular space
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005737	0.986	cytoplasm
GO:0016020	0.950	membrane
GO:0005886	0.923	plasma membrane
GO:0043230	0.901	extracellular organelle
GO:0031982	0.895	vesicle
GO:0070062	0.893	extracellular exosome
GO:0070013	0.858	intracellular organelle lumen
GO:0005634	0.829	nucleus
GO:0012505	0.802	endomembrane system
GO:0032991	0.447	protein-containing complex
GO:0031410	0.375	cytoplasmic vesicle
GO:0031090	0.322	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]