StarFunc result for job id P25391

User Input

>input (1400 residues)
MRGGVLLVLLLCVAAQCRQRGLFPAILNLASNAHISTNATCGEKGPEMFCKLVEHVPGRP
VRNPQCRICDGNSANPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTITLDLRQVFQVA
YVIIKAANAPRPGNWILERSLDGTTFSPWQYYAVSDSECLSRYNITPRRGPPTYRADDEV
ICTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLNADLMT
LSHREPKELDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDETTKKLQCQCEHNTCGES
CNRCCPGYHQQPWRPGTVSSGNTCEACNCHNKAKDCYYDESVAKQKKSLNTAGQFRGGGV
CINCLQNTMGINCETCIDGYYRPHKVSPYEDEPCRPCNCDPVGSLSSVCIKDDLHSDLHN
GKQPGQCPCKEGYTGEKCDRCQLGYKDYPTCVSCGCNPVGSASDEPCTGPCVCKENVEGK
ACDRCKPGFYNLKEKNPRGCSECFCFGVSDVCSSLSWPVGQVNSMSGWLVTDLISPRKIP
SQQDALGGRHQVSINNTAVMQRLAPKYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETV
DSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLM
TVLANVTHLLIRANYNSAKMALYRLESVSLDIASSNAIDLVVAADVEHCECPQGYTGTSC
ESCLSGYYRVDGILFGGICQPCECHGHAAECNVHGVCIACAHNTTGVHCEQCLPGFYGEP
SRGTPGDCQPCACPLTIASNNFSPTCHLNDGDEVVCDWCAPGYSGAWCERCADGYYGNPT
VPGESCVPCDCSGNVDPSEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCR
ACECHVKGSHSAVCHLETGLCDCKPNVTGQQCDQCLHGYYGLDSGHGCRPCNCSVAGSVS
DGCTDEGQCHCVPGVAGKRCDRCAHGFYAYQDGSCTPCDCPHTQNTCDPETGECVCPPHT
QGVKCEECEDGHWGYDAEVGCQACNCSLVGSTHHRCDVVTGHCQCKSKFGGRACDQCSLG
YRDFPDCVPCDCDLRGTSGDACNLEQGLCGCVEETGACPCKENVFGPQCNECREGTFALR
ADNPLGCSPCFCSGLSHLCSELEDYVRTPVTLGSDQPLLRVVSQSNLRGTTEGVYYQAPD
FLLDAATVRQHIRAEPFYWRLPQQFQGDQLMAYGGKLKYSVAFYSLDGVGTSNFEPQVLI
KGGRIRKQVIYMDAPAPENGVRQEQEVAMRENFWKYFNSVSEKPVTREDFMSVLSDIEYI
LIKASYGQGLQQSRISDISMEVGRKAEKLHPEEEVASLLENCVCPPGTVGFSCQDCAPGY
HRGKLPAGSDRGPRPLVAPC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q18823	0.360	0.316	1.013E-94	1633	0.275	0.236	Q18823.pdb.gz	LAM2_CAEEL Laminin-like protein lam-2 OS=Caenorhabditis elegans OX=6239 GN=lam-2 PE=1 SV=3
2	AFDB:Q1LVF0	0.226	0.201	4.570E-94	1593	0.266	0.234	Q1LVF0.pdb.gz	LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio OX=7955 GN=lamc1 PE=2 SV=2
3	AFDB:P15215	0.215	0.185	2.061E-93	1639	0.257	0.220	P15215.pdb.gz	LAMC1_DROME Laminin subunit gamma-1 OS=Drosophila melanogaster OX=7227 GN=LanB2 PE=2 SV=2
4	AFDB:P11047	0.222	0.196	4.730E-93	1609	0.270	0.235	P11047.pdb.gz	LAMC1_HUMAN Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3
5	AFDB:Q9Y6N6	0.241	0.216	9.784E-90	1575	0.261	0.232	Q9Y6N6.pdb.gz	LAMC3_HUMAN Laminin subunit gamma-3 OS=Homo sapiens OX=9606 GN=LAMC3 PE=1 SV=3
6	AFDB:F1QPJ1	0.233	0.203	2.366E-89	1643	0.256	0.218	F1QPJ1.pdb.gz	F1QPJ1_DANRE Laminin subunit gamma-3 OS=Danio rerio OX=7955 GN=lamc3 PE=4 SV=1
7	AFDB:Q9R0B6	0.243	0.216	7.811E-89	1581	0.267	0.237	Q9R0B6.pdb.gz	LAMC3_MOUSE Laminin subunit gamma-3 OS=Mus musculus OX=10090 GN=Lamc3 PE=1 SV=2
8	AFDB:A0A0G2KI51	0.303	0.421	1.432E-87	845	0.224	0.372	A0A0G2KI51.pdb.gz
9	AFDB:B7ZDA6	0.240	0.192	4.640E-77	1782	0.239	0.188	B7ZDA6.pdb.gz	B7ZDA6_DANRE Laminin subunit beta-2 precursor OS=Danio rerio OX=7955 GN=si:dkey-32e6.2 PE=1 SV=1
10	AFDB:D3ZQN7	0.243	0.194	4.329E-76	1786	0.240	0.188	D3ZQN7.pdb.gz	D3ZQN7_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=3
11	PDB:1xpwA	0.073	0.607	2.083E-4	143	0.019	0.189	1xpwA.pdb.gz
12	PDB:1k12A	0.082	0.631	6.200E-4	158	0.017	0.152	1k12A.pdb.gz	A novel fucose recognition fold involved in innate immunity.
13	PDB:7qe7L	0.089	0.586	2.520E-3	183	0.018	0.137	7qe7L.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
14	PDB:8a3tA	0.089	0.496	3.267E-3	219	0.016	0.105	8a3tA.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
15	PDB:5es4B	0.056	0.097	3.818E-3	674	0.033	0.068	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
16	PDB:4g1eB	0.052	0.084	4.461E-3	709	0.037	0.073	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
17	PDB:7drtB	0.075	0.173	6.093E-3	496	0.021	0.060	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.
18	PDB:5e7gA	0.054	0.133	2.012E-2	446	0.016	0.052	5e7gA.pdb.gz	Molecular Dissection of Xyloglucan Recognition in a Prominent Human Gut Symbiont.
19	PDB:7nxdB	0.057	0.100	2.351E-2	690	0.039	0.078	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
20	PDB:7qfqA	0.065	0.070	2.747E-2	1291	0.019	0.020	7qfqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JWX2	0.0	1598	3121	0.545	0.244	A0A0G2JWX2_RAT Laminin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Lama2 PE=1 SV=1
2	A0A8I5ZPP7	0.0	1586	3137	0.545	0.243	A0A8I5ZPP7_RAT Laminin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Lama2 PE=1 SV=1
3	F1M614	0.0	1597	3117	0.545	0.245	F1M614_RAT Laminin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Lama2 PE=4 SV=4
4	F1MMT2	0.0	1582	1964	0.545	0.388	F1MMT2_BOVIN Laminin subunit alpha 2 OS=Bos taurus OX=9913 GN=LAMA2 PE=4 SV=3
5	G5ECE3	0.0	959	3102	0.407	0.184	LAM3_CAEEL Laminin subunit alpha lam-3 OS=Caenorhabditis elegans OX=6239 GN=lam-3 PE=1 SV=1
6	G8IHU0	0.0	1504	3078	0.516	0.235	G8IHU0_DANRE Laminin alpha 2 chain short splice variant OS=Danio rerio OX=7955 GN=Lama2 PE=1 SV=1
7	P19137	0.0	2456	3083	0.814	0.369	LAMA1_MOUSE Laminin subunit alpha-1 OS=Mus musculus OX=10090 GN=Lama1 PE=1 SV=2
8	P24043	0.0	1618	3122	0.552	0.248	LAMA2_HUMAN Laminin subunit alpha-2 OS=Homo sapiens OX=9606 GN=LAMA2 PE=1 SV=4
9	P25391	0.0	2954	3075	1.000	0.455	LAMA1_HUMAN Laminin subunit alpha-1 OS=Homo sapiens OX=9606 GN=LAMA1 PE=1 SV=2
10	Q45H72	0.0	1819	3075	0.616	0.281	Q45H72_DANRE Laminin alpha 1 OS=Danio rerio OX=7955 GN=lama1 PE=1 SV=1
11	Q60675	0.0	1605	3118	0.546	0.245	LAMA2_MOUSE Laminin subunit alpha-2 OS=Mus musculus OX=10090 GN=Lama2 PE=1 SV=2
12	Q8IP51	0.0	722	3375	0.358	0.148	Q8IP51_DROME Wing blister, isoform B OS=Drosophila melanogaster OX=7227 GN=wb PE=4 SV=1
13	Q9XZC9	0.0	723	3367	0.358	0.149	Q9XZC9_DROME Laminin alpha1,2 OS=Drosophila melanogaster OX=7227 GN=wb PE=2 SV=1
14	R9PY40	0.0	723	3001	0.358	0.167	R9PY40_DROME Wing blister, isoform G OS=Drosophila melanogaster OX=7227 GN=wb PE=4 SV=1
15	Q18823	8.97e-178	574	1633	0.270	0.231	LAM2_CAEEL Laminin-like protein lam-2 OS=Caenorhabditis elegans OX=6239 GN=lam-2 PE=1 SV=3
16	Q1LVF0	2.64e-170	553	1593	0.275	0.242	LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio OX=7955 GN=lamc1 PE=2 SV=2
17	P15215	9.21e-170	553	1639	0.271	0.232	LAMC1_DROME Laminin subunit gamma-1 OS=Drosophila melanogaster OX=7227 GN=LanB2 PE=2 SV=2
18	P11047	1.28e-167	546	1609	0.271	0.236	LAMC1_HUMAN Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3
19	F1MAA7	1.52e-167	546	1607	0.266	0.232	F1MAA7_RAT Laminin subunit gamma 1 OS=Rattus norvegicus OX=10116 GN=Lamc1 PE=1 SV=1
20	F1MD77	3.44e-166	542	1608	0.267	0.233	F1MD77_BOVIN Laminin subunit gamma 1 OS=Bos taurus OX=9913 GN=LAMC1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00052 Laminin_B	2.2e-67	236.6	Laminin B (Domain IV)
2	PF00053 Laminin_EGF	5.2e-101	342.0	Laminin EGF domain
3	PF00055 Laminin_N	1.6e-61	219.4	Laminin N-terminal (Domain VI)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374309

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000442600	0.996	Dystroglycan
2	9606.ENSP00000379350	0.981	Integrin beta-1
3	9606.ENSP00000296585	0.961	Integrin alpha-2
4	9606.ENSP00000386896	0.957	Integrin alpha-6
5	9606.ENSP00000452120	0.957	Integrin alpha-7
6	9606.ENSP00000282588	0.954	Integrin alpha-1
7	9606.ENSP00000007722	0.953	Integrin alpha-3
8	9606.ENSP00000222399	0.953	Laminin subunit beta-1
9	9606.ENSP00000375778	0.947	Laminin subunit beta-3
10	9606.ENSP00000265171	0.942	Pro-epidermal growth factor
11	9606.ENSP00000388325	0.942	Laminin subunit beta-2
12	9606.ENSP00000258341	0.939	Laminin subunit gamma-1
13	9606.ENSP00000200181	0.938	Integrin beta-4
14	9606.ENSP00000252999	0.928	Laminin subunit alpha-5
15	9606.ENSP00000354360	0.928	Laminin subunit gamma-3
16	9606.ENSP00000230538	0.927	Laminin subunit alpha-4
17	9606.ENSP00000324532	0.923	Laminin subunit alpha-3
18	9606.ENSP00000368678	0.922	Agrin
19	9606.ENSP00000261769	0.917	Cadherin-1
20	9606.ENSP00000340937	0.917	Collagen alpha-1(XVII) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.998	structural molecule activity
GO:0005201	0.747	extracellular matrix structural constituent
GO:0097367	0.564	carbohydrate derivative binding
GO:0008289	0.518	lipid binding
GO:0051861	0.396	glycolipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048731	0.985	system development
GO:0009987	0.977	cellular process
GO:0030154	0.867	cell differentiation
GO:0007399	0.801	nervous system development
GO:0009653	0.779	anatomical structure morphogenesis
GO:0048513	0.742	animal organ development
GO:0048468	0.676	cell development
GO:0050896	0.658	response to stimulus
GO:0090162	0.626	establishment of epithelial cell polarity
GO:0045198	0.607	establishment of epithelial cell apical/basal polarity
GO:0035295	0.474	tube development
GO:0022008	0.463	neurogenesis
GO:0071840	0.390	cellular component organization or biogenesis
GO:0016043	0.364	cellular component organization
GO:0065007	0.354	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0032991	0.994	protein-containing complex
GO:0005576	0.990	extracellular region
GO:0031012	0.990	extracellular matrix
GO:0062023	0.977	collagen-containing extracellular matrix
GO:0005604	0.967	basement membrane
GO:0043256	0.930	laminin complex
GO:0016020	0.611	membrane
GO:0030054	0.589	cell junction
GO:0005615	0.495	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]