StarFunc result for job id P25440

User Input

>input (801 residues)
MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPAN
PPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQP
MDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASM
PQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNI
PHPSVISSPLLKSLHSAGPPLLAVTAAPPAQPLAKKKGVKRKADTTTPTPTAILAPGSPA
SPPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQLKHCNGILKEL
LSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRL
MFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLEPGPLPVSTAMPPGLAKSSSES
SSEESSSESSSEEEEEEDEEDEEEEESESSDSEEERAHRLAELQEQLRAVHEQLAALSQG
PISKPKRKREKKEKKKKRKAEKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAAL
GPSGFGPSGGSGTKLPKKATKTAPPALPTGYDSEEEEESRPMSYDEKRQLSLDINKLPGE
KLGRVVHIIQAREPSLRDSNPEEIEIDFETLKPSTLRELERYVLSCLRKKPRKPYTIKKP
VGKTKEELALEKKRELEKRLQDVSGQLNSTKKPPKKANEKTESSSAQQVAVSRLSASSSS
SDSSSSSSSSSSSDTSDSDSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RCR5	0.319	0.319	5.641E-94	801	1.000	1.000	A0A024RCR5.pdb.gz
2	AFDB:Q8AWX9	0.298	0.297	2.311E-63	806	0.627	0.623	Q8AWX9.pdb.gz
3	AFDB:A8CYQ7	0.290	0.279	2.676E-63	838	0.630	0.603	A8CYQ7.pdb.gz
4	AFDB:F8W3C9	0.366	0.362	1.175E-58	811	0.568	0.561	F8W3C9.pdb.gz
5	AFDB:Q9ESU6	0.257	0.166	1.174E-52	1400	0.504	0.289	Q9ESU6.pdb.gz	BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus OX=10090 GN=Brd4 PE=1 SV=2
6	AFDB:O60885	0.265	0.180	6.482E-52	1362	0.508	0.299	O60885.pdb.gz	BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2
7	AFDB:F1R5H6	0.236	0.147	2.919E-50	1444	0.486	0.269	F1R5H6.pdb.gz	BRD4_DANRE Bromodomain-containing protein 4 OS=Danio rerio OX=7955 GN=brd4 PE=1 SV=1
8	AFDB:Q58F21	0.171	0.145	1.462E-49	947	0.461	0.390	Q58F21.pdb.gz	BRDT_HUMAN Bromodomain testis-specific protein OS=Homo sapiens OX=9606 GN=BRDT PE=1 SV=4
9	AFDB:D4A7T3	0.267	0.234	3.695E-49	952	0.467	0.393	D4A7T3.pdb.gz	BRDT_RAT Bromodomain testis-specific protein OS=Rattus norvegicus OX=10116 GN=Brdt PE=1 SV=1
10	AFDB:P13709	0.211	0.107	6.576E-42	2038	0.489	0.192	P13709.pdb.gz	FSH_DROME Homeotic protein female sterile OS=Drosophila melanogaster OX=7227 GN=fs(1)h PE=1 SV=2
11	PDB:5svan	0.067	0.248	2.383E-1	200	0.020	0.080	5svan.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
12	PDB:1x8zA	0.062	0.210	2.363	151	0.017	0.093	1x8zA.pdb.gz
13	PDB:3pjaL	0.065	0.185	3.326	223	0.015	0.054	3pjaL.pdb.gz
14	PDB:6v8oO	0.087	0.168	3.667	384	0.020	0.042	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
15	PDB:5jxdA	0.051	0.153	4.043	186	0.022	0.097	5jxdA.pdb.gz	The Tnfaip8-PE complex is a novel upstream effector in the anti-autophagic action of insulin
16	PDB:6gejS	0.044	0.128	4.245	208	0.035	0.135	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
17	PDB:2wj8N	0.053	0.095	4.458	378	0.017	0.037	2wj8N.pdb.gz	Crystal Structure of a Nucleocapsid-Like Nucleoprotein-RNA Complex of Respiratory Syncytial Virus
18	PDB:4f0tB	0.054	0.174	4.681	172	0.029	0.134	4f0tB.pdb.gz
19	PDB:7be8A	0.054	0.167	5.161	219	0.016	0.059	7be8A.pdb.gz	Repair of Iron Center Proteins-A Different Class of Hemerythrin-like Proteins.
20	PDB:1rj1A	0.074	0.278	5.419	148	0.020	0.108	1rj1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QQP6	0.0	655	683	0.496	0.581	F1QQP6_DANRE Bromodomain-containing 3a OS=Danio rerio OX=7955 GN=brd3 PE=1 SV=1
2	F1R5H6	0.0	594	1444	0.472	0.262	BRD4_DANRE Bromodomain-containing protein 4 OS=Danio rerio OX=7955 GN=brd4 PE=1 SV=1
3	H0Y6K2	0.0	1600	807	0.988	0.980	H0Y6K2_HUMAN Bromodomain containing 2 (Fragment) OS=Homo sapiens OX=9606 GN=BRD2 PE=1 SV=1
4	H0Y799	0.0	592	296	0.356	0.963	H0Y799_HUMAN Bromodomain containing 2 (Fragment) OS=Homo sapiens OX=9606 GN=BRD2 PE=1 SV=1
5	P25440	0.0	1622	801	1.000	1.000	BRD2_HUMAN Bromodomain-containing protein 2 OS=Homo sapiens OX=9606 GN=BRD2 PE=1 SV=2
6	Q15059	0.0	697	726	0.536	0.591	BRD3_HUMAN Bromodomain-containing protein 3 OS=Homo sapiens OX=9606 GN=BRD3 PE=1 SV=1
7	Q58F21	0.0	625	947	0.449	0.380	BRDT_HUMAN Bromodomain testis-specific protein OS=Homo sapiens OX=9606 GN=BRDT PE=1 SV=4
8	Q7JJ13	0.0	1554	798	0.964	0.967	BRD2_MOUSE Bromodomain-containing protein 2 OS=Mus musculus OX=10090 GN=Brd2 PE=1 SV=1
9	Q91Y44	0.0	615	956	0.478	0.401	BRDT_MOUSE Bromodomain testis-specific protein OS=Mus musculus OX=10090 GN=Brdt PE=1 SV=3
10	U3KQA6	0.0	1138	552	0.689	1.000	U3KQA6_HUMAN Bromodomain containing 2 (Fragment) OS=Homo sapiens OX=9606 GN=BRD2 PE=1 SV=1
11	O60885	3.52e-168	524	1362	0.378	0.222	BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2
12	Q9ESU6	1.62e-167	523	1400	0.380	0.217	BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus OX=10090 GN=Brd4 PE=1 SV=2
13	Q1LWX7	2.77e-164	499	832	0.382	0.368	Q1LWX7_DANRE Bromodomain-containing 2 OS=Danio rerio OX=7955 GN=brd2 PE=1 SV=1
14	A8CYR1	3.54e-162	493	836	0.382	0.366	A8CYR1_DANRE Bromodomain-containing 2a OS=Danio rerio OX=7955 GN=brd2 PE=1 SV=1
15	A8CYR7	8.90e-87	278	276	0.186	0.540	A8CYR7_DANRE Bromodomain-containing protein 2 OS=Danio rerio OX=7955 GN=brd2b PE=2 SV=1
16	Q95Y80	3.98e-73	258	853	0.250	0.234	BET1_CAEEL Bromodomain-containing protein bet-1 OS=Caenorhabditis elegans OX=6239 GN=bet-1 PE=1 SV=3
17	P13709	1.11e-64	238	2038	0.177	0.070	FSH_DROME Homeotic protein female sterile OS=Drosophila melanogaster OX=7227 GN=fs(1)h PE=1 SV=2
18	D4A7T3	7.63e-39	157	952	0.125	0.105	BRDT_RAT Bromodomain testis-specific protein OS=Rattus norvegicus OX=10116 GN=Brdt PE=1 SV=1
19	P35817	3.87e-32	135	686	0.139	0.162	BDF1_YEAST Bromodomain-containing factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BDF1 PE=1 SV=3
20	Q9VCG6	7.22e-29	124	513	0.132	0.207	Q9VCG6_DROME IP14417p1 OS=Drosophila melanogaster OX=7227 GN=tbrd-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17035 BET	1e-23	94.6	Bromodomain extra-terminal - transcription regulation
2	PF00439 Bromodomain	4.8e-38	140.5	Bromodomain
3	PF15761 IMUP	72	15.5	Immortalisation up-regulated protein
4	PF04546 Sigma70_ner	13	17.2	Sigma-70, non-essential region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000030782

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000000614	0.853	Runt-related transcription factor
2	9598.ENSPTRP00000030821	0.840	Kinesin-like protein
3	9598.ENSPTRP00000028020	0.811	Belongs to the histone H2A family.
4	9598.ENSPTRP00000058203	0.800	Pan troglodytes TATA box binding protein (TBP), mRNA
5	9598.ENSPTRP00000036573	0.794	Cyclin-dependent kinase 9
6	9598.ENSPTRP00000017884	0.781	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
7	9598.ENSPTRP00000024841	0.775	Pan troglodytes E1A binding protein p300 (EP300), mRNA
8	9598.ENSPTRP00000048051	0.739	Damage-specific DNA binding protein 1, 127kDa
9	9598.ENSPTRP00000009525	0.726	RNA helicase
10	9598.ENSPTRP00000016856	0.722	Mindbomb E3 ubiquitin protein ligase 1
11	9598.ENSPTRP00000008350	0.718	Cyclin-T1
12	9598.ENSPTRP00000032725	0.712	Belongs to the histone H2A family.
13	9598.ENSPTRP00000046996	0.701	Pan troglodytes DNA methyltransferase 1 associated protein 1 (DMAP1), mRNA
14	9598.ENSPTRP00000034184	0.695	Beta-defensin 1
15	9598.ENSPTRP00000051280	0.694	Uncharacterized protein
16	9598.ENSPTRP00000033329	0.688	Uncharacterized protein
17	9598.ENSPTRP00000036845	0.686	Bromodomain containing 3
18	9598.ENSPTRP00000006874	0.684	Belongs to the cyclin family.
19	9598.ENSPTRP00000008150	0.679	Uncharacterized protein
20	9598.ENSPTRP00000030781	0.677	Major histocompatibility complex, class II, DM alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	0.999	chromatin binding
GO:0070577	0.999	lysine-acetylated histone binding
GO:0004674	0.998	protein serine/threonine kinase activity
GO:0044877	0.741	protein-containing complex binding
GO:1901363	0.613	heterocyclic compound binding
GO:0097159	0.592	organic cyclic compound binding
GO:0003676	0.500	nucleic acid binding
GO:0003677	0.314	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.974	cellular process
GO:0019222	0.965	regulation of metabolic process
GO:0060255	0.964	regulation of macromolecule metabolic process
GO:0010468	0.946	regulation of gene expression
GO:0050794	0.939	regulation of cellular process
GO:0032502	0.919	developmental process
GO:0032501	0.729	multicellular organismal process
GO:0031323	0.649	regulation of cellular metabolic process
GO:0080090	0.648	regulation of primary metabolic process
GO:0051171	0.648	regulation of nitrogen compound metabolic process
GO:0048856	0.584	anatomical structure development
GO:0006325	0.528	chromatin organization
GO:0019219	0.404	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.398	regulation of biosynthetic process
GO:0007275	0.371	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0016607	0.980	nuclear speck
GO:0005737	0.917	cytoplasm
GO:0032991	0.341	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.998	Phosphotransferases with an alcohol group as acceptor.

[back to server]