StarFunc result for job id P25445

User Input

>input (335 residues)
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCH
KPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCT
RTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLL
LLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVM
TLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKK
ANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P25445	1.000	1.000	3.381E-61	335	1.000	1.000	P25445.pdb.gz	TNR6_HUMAN Tumor necrosis factor receptor superfamily member 6 OS=Homo sapiens OX=9606 GN=FAS PE=1 SV=1
2	AFDB:P25446	0.372	0.380	2.126E-30	327	0.475	0.486	P25446.pdb.gz	TNR6_MOUSE Tumor necrosis factor receptor superfamily member 6 OS=Mus musculus OX=10090 GN=Fas PE=1 SV=2
3	AFDB:Q63199	0.350	0.361	2.689E-30	324	0.484	0.500	Q63199.pdb.gz	TNR6_RAT Tumor necrosis factor receptor superfamily member 6 OS=Rattus norvegicus OX=10116 GN=Fas PE=1 SV=1
4	AFDB:F1QG24	0.304	0.343	7.342E-20	293	0.233	0.266	F1QG24.pdb.gz	F1QG24_DANRE Tumor necrosis factor receptor superfamily member 6 OS=Danio rerio OX=7955 GN=fas PE=4 SV=1
5	AFDB:Q6E5U7	0.328	0.351	1.671E-19	312	0.251	0.269	Q6E5U7.pdb.gz	Q6E5U7_ICTPU Tumor necrosis factor receptor superfamily member 6 OS=Ictalurus punctatus OX=7998 GN=fas PE=2 SV=1
6	AFDB:P19438	0.268	0.203	9.768E-14	455	0.215	0.158	P19438.pdb.gz	TNR1A_HUMAN Tumor necrosis factor receptor superfamily member 1A OS=Homo sapiens OX=9606 GN=TNFRSF1A PE=1 SV=1
7	AFDB:F1QQS0	0.265	0.233	1.563E-13	389	0.191	0.165	F1QQS0.pdb.gz
8	AFDB:Q93038	0.274	0.225	5.061E-13	417	0.206	0.165	Q93038.pdb.gz	TNR25_HUMAN Tumor necrosis factor receptor superfamily member 25 OS=Homo sapiens OX=9606 GN=TNFRSF25 PE=1 SV=2
9	AFDB:P22934	0.287	0.215	8.098E-13	461	0.221	0.161	P22934.pdb.gz	TNR1A_RAT Tumor necrosis factor receptor superfamily member 1A OS=Rattus norvegicus OX=10116 GN=Tnfrsf1a PE=2 SV=2
10	AFDB:O00220	0.261	0.191	1.086E-12	468	0.191	0.137	O00220.pdb.gz	TR10A_HUMAN Tumor necrosis factor receptor superfamily member 10A OS=Homo sapiens OX=9606 GN=TNFRSF10A PE=1 SV=3
11	PDB:7ajtUO	0.124	0.090	7.377E-1	493	0.069	0.047	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
12	PDB:7d5sB2	0.116	0.057	1.113	851	0.087	0.034	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
13	PDB:3j9kB	0.190	0.484	1.408	102	0.033	0.108	3j9kB.pdb.gz	Structure of the apoptosome: mechanistic insights into activation of an initiator caspase from Drosophila.
14	PDB:3fh6G	0.110	0.130	1.583	254	0.075	0.098	3fh6G.pdb.gz
15	PDB:4jrzA	0.100	0.185	1.889	155	0.063	0.135	4jrzA.pdb.gz	Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
16	PDB:7mq8LL	0.118	0.086	2.003	510	0.057	0.037	7mq8LL.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:6z3wC	0.079	0.144	2.687	177	0.072	0.136	6z3wC.pdb.gz
18	PDB:5juyB	0.189	0.059	2.849	1234	0.036	0.010	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
19	PDB:5oqj1	0.102	0.076	2.849	491	0.048	0.033	5oqj1.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
20	PDB:1cnt1	0.121	0.214	3.205	150	0.051	0.113	1cnt1.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P25445	0.0	686	335	1.000	1.000	TNR6_HUMAN Tumor necrosis factor receptor superfamily member 6 OS=Homo sapiens OX=9606 GN=FAS PE=1 SV=1
2	K9J972	1.43e-139	395	197	0.564	0.959	K9J972_HUMAN FAS receptor variant 9 OS=Homo sapiens OX=9606 GN=FAS PE=1 SV=1
3	P25446	2.58e-100	300	327	0.484	0.495	TNR6_MOUSE Tumor necrosis factor receptor superfamily member 6 OS=Mus musculus OX=10090 GN=Fas PE=1 SV=2
4	Q63199	2.15e-99	298	324	0.484	0.500	TNR6_RAT Tumor necrosis factor receptor superfamily member 6 OS=Rattus norvegicus OX=10116 GN=Fas PE=1 SV=1
5	W5U6M1	1.33e-29	117	311	0.242	0.260	W5U6M1_ICTPU Tumor necrosis factor receptor superfamily member 6 OS=Ictalurus punctatus OX=7998 GN=FAS PE=2 SV=1
6	Q6E5U7	1.01e-28	114	312	0.242	0.260	Q6E5U7_ICTPU Tumor necrosis factor receptor superfamily member 6 OS=Ictalurus punctatus OX=7998 GN=fas PE=2 SV=1
7	F1QG24	1.20e-24	103	293	0.227	0.259	F1QG24_DANRE Tumor necrosis factor receptor superfamily member 6 OS=Danio rerio OX=7955 GN=fas PE=4 SV=1
8	Q9DF34	9.74e-10	61.2	357	0.230	0.216	Q9DF34_DANRE Death receptor OS=Danio rerio OX=7955 GN=zgc:103531 PE=2 SV=1
9	Q0PKX6	6.12e-09	59.3	436	0.137	0.106	Q0PKX6_DANRE Ovarian TNF receptor OS=Danio rerio OX=7955 GN=otr PE=2 SV=1
10	Q9ER63	3.76e-08	54.7	176	0.125	0.239	TNR23_MOUSE Tumor necrosis factor receptor superfamily member 23 OS=Mus musculus OX=10090 GN=Tnfrsf23 PE=2 SV=2
11	P36941	4.04e-08	56.6	435	0.146	0.113	TNR3_HUMAN Tumor necrosis factor receptor superfamily member 3 OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=1
12	O14763	1.12e-07	55.5	440	0.122	0.093	TR10B_HUMAN Tumor necrosis factor receptor superfamily member 10B OS=Homo sapiens OX=9606 GN=TNFRSF10B PE=1 SV=2
13	F1QD95	1.19e-07	55.1	418	0.146	0.117	F1QD95_DANRE Hematopoietic death receptor OS=Danio rerio OX=7955 GN=ZH-DR PE=4 SV=1
14	B8YBG7	1.20e-07	55.1	336	0.149	0.149	B8YBG7_RAT Tumor necrosis factor receptor superfamily member 10b OS=Rattus norvegicus OX=10116 GN=Tnfrsf10b PE=2 SV=1
15	O00220	1.33e-07	55.1	468	0.125	0.090	TR10A_HUMAN Tumor necrosis factor receptor superfamily member 10A OS=Homo sapiens OX=9606 GN=TNFRSF10A PE=1 SV=3
16	Q92956	1.38e-07	54.3	283	0.170	0.201	TNR14_HUMAN Tumor necrosis factor receptor superfamily member 14 OS=Homo sapiens OX=9606 GN=TNFRSF14 PE=1 SV=3
17	A0A0G2JZE1	2.83e-07	53.9	336	0.146	0.146	A0A0G2JZE1_RAT TNF receptor superfamily member 10b OS=Rattus norvegicus OX=10116 GN=Tnfrsf10b PE=4 SV=2
18	A0A1W2Q6I0	3.99e-07	53.1	331	0.140	0.142	A0A1W2Q6I0_RAT TNF receptor superfamily member 10b OS=Rattus norvegicus OX=10116 GN=Tnfrsf10b PE=4 SV=2
19	Q93038	9.10e-07	52.4	417	0.096	0.077	TNR25_HUMAN Tumor necrosis factor receptor superfamily member 25 OS=Homo sapiens OX=9606 GN=TNFRSF25 PE=1 SV=2
20	P41272	1.08e-06	51.6	250	0.090	0.120	CD27_MOUSE CD27 antigen OS=Mus musculus OX=10090 GN=Cd27 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00531 Death	3.2e-12	57.8	Death domain
2	PF03569 Peptidase_C8	91	14.0	Peptidase family C8
3	PF00020 TNFR_c6	1.3e-13	62.5	TNFR/NGFR cysteine-rich region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347979

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301838	0.999	FAS-associated death domain protein
2	9606.ENSP00000351273	0.999	Caspase-8
3	9606.ENSP00000356694	0.999	Tumor necrosis factor ligand superfamily member 6
4	9606.ENSP00000286186	0.997	Caspase-10
5	9606.ENSP00000312455	0.996	CASP8 and FADD-like apoptosis regulator
6	9606.ENSP00000363668	0.995	Death domain-associated protein 6
7	9606.ENSP00000394794	0.995	Tyrosine-protein phosphatase non-receptor type 13
8	9606.ENSP00000379457	0.992	FAS-associated factor 1
9	9606.ENSP00000259808	0.985	Receptor-interacting serine/threonine-protein kinase 1
10	9606.ENSP00000341268	0.983	Tumor necrosis factor receptor type 1-associated DEATH domain protein
11	9606.ENSP00000318822	0.982	BH3-interacting domain death agonist
12	9606.ENSP00000351908	0.977	Mitogen-activated protein kinase kinase kinase 5
13	9606.ENSP00000162749	0.975	Tumor necrosis factor receptor superfamily member 1A
14	9606.ENSP00000362680	0.971	Proto-oncogene tyrosine-protein kinase Src
15	9606.ENSP00000269305	0.967	Cellular tumor antigen p53
16	9606.ENSP00000356042	0.961	Ezrin
17	9606.ENSP00000321951	0.960	Protein lifeguard 2
18	9606.ENSP00000358327	0.953	Caspase-7
19	9606.ENSP00000477613	0.950	Baculoviral IAP repeat-containing protein 2
20	9606.ENSP00000340409	0.948	Sphingomyelin phosphodiesterase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005516	1.000	calmodulin binding
GO:0042802	0.999	identical protein binding
GO:0019900	0.995	kinase binding
GO:0004888	0.375	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0007154	0.996	cell communication
GO:0051716	0.996	cellular response to stimulus
GO:0048518	0.994	positive regulation of biological process
GO:0060255	0.991	regulation of macromolecule metabolic process
GO:0023052	0.986	signaling
GO:0007165	0.982	signal transduction
GO:0080090	0.981	regulation of primary metabolic process
GO:0048522	0.981	positive regulation of cellular process
GO:0048583	0.979	regulation of response to stimulus
GO:0051171	0.975	regulation of nitrogen compound metabolic process
GO:0031323	0.959	regulation of cellular metabolic process
GO:0009893	0.956	positive regulation of metabolic process
GO:0010604	0.953	positive regulation of macromolecule metabolic process
GO:0042325	0.952	regulation of phosphorylation
GO:0048523	0.950	negative regulation of cellular process
GO:0010646	0.940	regulation of cell communication
GO:0006915	0.936	apoptotic process
GO:0080134	0.932	regulation of response to stress
GO:0009966	0.927	regulation of signal transduction
GO:0006950	0.920	response to stress
GO:0051173	0.919	positive regulation of nitrogen compound metabolic process
GO:0042221	0.918	response to chemical
GO:0097190	0.915	apoptotic signaling pathway
GO:0048584	0.911	positive regulation of response to stimulus
GO:0043068	0.907	positive regulation of programmed cell death
GO:0051246	0.905	regulation of protein metabolic process
GO:0070887	0.903	cellular response to chemical stimulus
GO:0065009	0.900	regulation of molecular function
GO:0007166	0.897	cell surface receptor signaling pathway
GO:0051247	0.892	positive regulation of protein metabolic process
GO:0010562	0.891	positive regulation of phosphorus metabolic process
GO:0042981	0.889	regulation of apoptotic process
GO:0071496	0.887	cellular response to external stimulus
GO:0044093	0.887	positive regulation of molecular function
GO:0031399	0.886	regulation of protein modification process
GO:1902531	0.885	regulation of intracellular signal transduction
GO:0045937	0.874	positive regulation of phosphate metabolic process
GO:0050790	0.871	regulation of catalytic activity
GO:0009967	0.870	positive regulation of signal transduction
GO:0043085	0.864	positive regulation of catalytic activity
GO:0043065	0.861	positive regulation of apoptotic process
GO:0051336	0.852	regulation of hydrolase activity
GO:0009991	0.846	response to extracellular stimulus
GO:0042327	0.844	positive regulation of phosphorylation
GO:0051345	0.830	positive regulation of hydrolase activity
GO:0052548	0.810	regulation of endopeptidase activity
GO:0045862	0.799	positive regulation of proteolysis
GO:0033554	0.797	cellular response to stress
GO:2000116	0.776	regulation of cysteine-type endopeptidase activity
GO:2001056	0.741	positive regulation of cysteine-type endopeptidase activity
GO:0071260	0.729	cellular response to mechanical stimulus
GO:0097191	0.725	extrinsic apoptotic signaling pathway
GO:0043281	0.725	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0070265	0.720	necrotic cell death
GO:0043069	0.707	negative regulation of programmed cell death
GO:0043280	0.696	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0031667	0.682	response to nutrient levels
GO:0031401	0.664	positive regulation of protein modification process
GO:0071840	0.600	cellular component organization or biogenesis
GO:0043066	0.585	negative regulation of apoptotic process
GO:0016043	0.568	cellular component organization
GO:0001932	0.543	regulation of protein phosphorylation
GO:0001934	0.504	positive regulation of protein phosphorylation
GO:0010468	0.482	regulation of gene expression
GO:2001233	0.468	regulation of apoptotic signaling pathway
GO:0080135	0.425	regulation of cellular response to stress
GO:0043408	0.391	regulation of MAPK cascade
GO:0010033	0.383	response to organic substance
GO:0051239	0.368	regulation of multicellular organismal process
GO:0002376	0.335	immune system process
GO:0009889	0.335	regulation of biosynthetic process
GO:0031326	0.333	regulation of cellular biosynthetic process
GO:0010556	0.330	regulation of macromolecule biosynthetic process
GO:2001235	0.329	positive regulation of apoptotic signaling pathway
GO:0070302	0.328	regulation of stress-activated protein kinase signaling cascade
GO:0051252	0.326	regulation of RNA metabolic process
GO:2001141	0.323	regulation of RNA biosynthetic process
GO:0006355	0.309	regulation of DNA-templated transcription
GO:0034198	0.307	cellular response to amino acid starvation
GO:0036296	0.304	response to increased oxygen levels
GO:1902533	0.304	positive regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	0.996	cytosol
GO:0032991	0.995	protein-containing complex
GO:0005654	0.995	nucleoplasm
GO:0005576	0.993	extracellular region
GO:0005615	0.978	extracellular space
GO:0031982	0.936	vesicle
GO:0070062	0.906	extracellular exosome
GO:0009986	0.858	cell surface
GO:0098796	0.854	membrane protein complex
GO:0098797	0.687	plasma membrane protein complex
GO:0045121	0.629	membrane raft
GO:0012505	0.448	endomembrane system
GO:0031264	0.443	death-inducing signaling complex
GO:0016604	0.437	nuclear body
GO:0031265	0.408	CD95 death-inducing signaling complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]