StarFunc result for job id P25490

User Input

>input (414 residues)
MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDDDEDGGGGDHG
GGGGHGHAGHHHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDG
LRAEDGFEDQILIPVPAPAGGDDDYIEQTLVTVAAAGKSGGGGSSSSGGGRVKKGGGKKS
GKKSYLSGGAGAAGGGGADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEE
QIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPH
KGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGC
GKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P25490	1.000	1.000	1.780E-67	414	1.000	1.000	P25490.pdb.gz	TYY1_HUMAN Transcriptional repressor protein YY1 OS=Homo sapiens OX=9606 GN=YY1 PE=1 SV=2
2	AFDB:A0JC51	0.202	0.159	3.581E-12	530	0.249	0.194	A0JC51.pdb.gz	ZIC4_XENLA Zinc finger protein ZIC 4 OS=Xenopus laevis OX=8355 GN=zic4 PE=2 SV=1
3	AFDB:A7KQF2	0.202	0.159	1.709E-11	530	0.234	0.183	A7KQF2.pdb.gz
4	AFDB:Q4WT96	0.248	0.184	1.838E-10	570	0.205	0.149	Q4WT96.pdb.gz	Q4WT96_ASPFU C2H2 transcription factor, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_1G10080 PE=4 SV=1
5	AFDB:Q921B4	0.143	0.081	2.513E-10	824	0.227	0.114	Q921B4.pdb.gz	NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus OX=10090 GN=Nrif2 PE=1 SV=1
6	AFDB:A0A0A0MT54	0.273	0.223	4.411E-10	522	0.208	0.165	A0A0A0MT54.pdb.gz	A0A0A0MT54_HUMAN Wilms tumor protein OS=Homo sapiens OX=9606 GN=WT1 PE=1 SV=2
7	AFDB:Q923B3	0.136	0.077	5.320E-10	828	0.220	0.110	Q923B3.pdb.gz	NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus OX=10090 GN=Nrif1 PE=1 SV=3
8	AFDB:Q96JB3	0.253	0.175	6.029E-10	615	0.239	0.161	Q96JB3.pdb.gz	HIC2_HUMAN Hypermethylated in cancer 2 protein OS=Homo sapiens OX=9606 GN=HIC2 PE=1 SV=2
9	AFDB:P41183	0.245	0.148	6.832E-10	707	0.203	0.119	P41183.pdb.gz	BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus OX=10090 GN=Bcl6 PE=1 SV=1
10	AFDB:O75626	0.253	0.132	7.273E-10	825	0.210	0.105	O75626.pdb.gz	PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens OX=9606 GN=PRDM1 PE=1 SV=2
11	PDB:7l08a	0.054	0.154	6.393E-1	108	0.031	0.120	7l08a.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
12	PDB:5tgcC	0.056	0.249	7.712E-1	67	0.017	0.104	5tgcC.pdb.gz	Actin-related proteins regulate the RSC chromatin remodeler by weakening intramolecular interactions of the Sth1 ATPase.
13	PDB:7m6jD	0.066	0.099	1.633	273	0.029	0.044	7m6jD.pdb.gz	An atomic model for the human septin hexamer by cryo-EM.
14	PDB:2ehjA	0.041	0.078	2.097	208	0.010	0.019	2ehjA.pdb.gz
15	PDB:7o9kC	0.040	0.065	2.097	255	0.007	0.012	7o9kC.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
16	PDB:7w59R	0.076	0.104	2.097	280	0.056	0.082	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
17	PDB:7f5yB	0.065	0.198	2.376	120	0.022	0.075	7f5yB.pdb.gz
18	PDB:3zqqC	0.042	0.108	2.693	134	0.022	0.067	3zqqC.pdb.gz
19	PDB:6qx91K	0.049	0.082	2.866	201	0.051	0.104	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
20	PDB:1nf3A	0.052	0.106	3.051	194	0.002	0.005	1nf3A.pdb.gz	Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A7Q7	0.0	780	403	0.932	0.958	A0A8I6A7Q7_RAT YY1 transcription factor OS=Rattus norvegicus OX=10116 GN=Yy1 PE=1 SV=1
2	F1NHV6	0.0	595	420	0.826	0.814	F1NHV6_CHICK YY2 transcription factor OS=Gallus gallus OX=9031 GN=YY2 PE=1 SV=2
3	P25490	0.0	845	414	1.000	1.000	TYY1_HUMAN Transcriptional repressor protein YY1 OS=Homo sapiens OX=9606 GN=YY1 PE=1 SV=2
4	Q00899	0.0	823	414	0.990	0.990	TYY1_MOUSE Transcriptional repressor protein YY1 OS=Mus musculus OX=10090 GN=Yy1 PE=1 SV=1
5	Q5ZMN5	0.0	594	420	0.824	0.812	Q5ZMN5_CHICK C2H2-type domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_1i20 PE=2 SV=1
6	Q7T1S3	0.0	603	357	0.763	0.885	Q7T1S3_DANRE Transcription factor YY1 OS=Danio rerio OX=7955 GN=fb59g10 PE=2 SV=1
7	Q7T304	0.0	524	354	0.703	0.822	Q7T304_DANRE YY1 transcription factor b OS=Danio rerio OX=7955 GN=fb68e12 PE=2 SV=1
8	Q8CHJ4	0.0	822	411	0.981	0.988	Q8CHJ4_RAT Transcription factor YY1 OS=Rattus norvegicus OX=10116 GN=Yy1 PE=1 SV=1
9	Q3TTC2	1.20e-138	403	378	0.548	0.601	TYY2_MOUSE Transcription factor YY2 OS=Mus musculus OX=10090 GN=Yy2 PE=2 SV=1
10	O15391	2.15e-137	399	372	0.548	0.610	TYY2_HUMAN Transcription factor YY2 OS=Homo sapiens OX=9606 GN=YY2 PE=2 SV=1
11	Q96MM3	3.72e-93	284	310	0.338	0.452	ZFP42_HUMAN Zinc finger protein 42 homolog OS=Homo sapiens OX=9606 GN=ZFP42 PE=1 SV=2
12	Q8ST83	1.38e-78	254	520	0.271	0.215	PHO_DROME Polycomb protein PHO OS=Drosophila melanogaster OX=7227 GN=pho PE=1 SV=2
13	Q9VSZ3	4.49e-63	216	669	0.229	0.142	Q9VSZ3_DROME LD31045p OS=Drosophila melanogaster OX=7227 GN=phol PE=1 SV=2
14	P22227	1.13e-59	197	288	0.210	0.302	ZFP42_MOUSE Zinc finger protein 42 OS=Mus musculus OX=10090 GN=Zfp42 PE=1 SV=1
15	Q2V3L3	1.27e-35	137	387	0.143	0.152	YY1_ARATH Zinc finger transcription factor YY1 OS=Arabidopsis thaliana OX=3702 GN=YY1 PE=1 SV=1
16	P52747	6.89e-26	112	638	0.126	0.082	ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens OX=9606 GN=ZNF143 PE=1 SV=2
17	Q5XIU2	7.02e-25	109	638	0.121	0.078	ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus OX=10116 GN=Znf143 PE=2 SV=2
18	O70230	7.70e-25	108	638	0.121	0.078	ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus OX=10090 GN=Znf143 PE=1 SV=2
19	Q1LYE3	3.25e-24	107	623	0.121	0.080	ZN143_DANRE Zinc finger protein 143 OS=Danio rerio OX=7955 GN=znf143 PE=2 SV=2
20	Q923T4	4.21e-24	106	484	0.138	0.118	Q923T4_MOUSE Zinc finger protein ZFEND OS=Mus musculus OX=10090 GN=Zfp358 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11105 CCAP	6.5e+02	11.7	Arthropod cardioacceleratory peptide 2a
2	PF01485 IBR	46	15.6	IBR domain, a half RING-finger domain
3	PF05691 Raffinose_syn	1e+02	12.1	Raffinose synthase or seed imbibition protein Sip1
4	PF00096 zf-C2H2	6.7e-14	62.6	Zinc finger, C2H2 type
5	PF13894 zf-C2H2_4	0.7	21.9	C2H2-type zinc finger
6	PF17017 zf-C2H2_aberr	26	16.4	Aberrant zinc-finger
7	PF13465 zf-H2C2_2	4e-12	57.2	Zinc-finger double domain
8	PF13909 zf-H2C2_5	9.4e+02	11.0	C2H2-type zinc-finger domain
9	PF14369 zinc_ribbon_9	1.9e+02	13.7	zinc-ribbon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262238

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263253	0.999	Histone acetyltransferase p300
2	9606.ENSP00000264867	0.999	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
3	9606.ENSP00000320147	0.999	Histone-lysine N-methyltransferase EZH2
4	9606.ENSP00000362649	0.999	Histone deacetylase 1
5	9606.ENSP00000430432	0.999	Histone deacetylase 2
6	9606.ENSP00000296504	0.998	Histone deacetylase complex subunit SAP30
7	9606.ENSP00000419494	0.998	RING1 and YY1-binding protein
8	9606.ENSP00000309555	0.995	Host cell factor 1
9	9606.ENSP00000269305	0.994	Cellular tumor antigen p53
10	9606.ENSP00000473172	0.994	RuvB-like 2
11	9606.ENSP00000302967	0.992	Histone deacetylase 3
12	9606.ENSP00000316578	0.992	Polycomb protein SUZ12
13	9606.ENSP00000356425	0.992	Ubiquitin carboxyl-terminal hydrolase isozyme L5
14	9606.ENSP00000307272	0.991	Regulatory-associated protein of mTOR
15	9606.ENSP00000258149	0.990	E3 ubiquitin-protein ligase Mdm2
16	9606.ENSP00000355205	0.988	DNA helicase INO80
17	9606.ENSP00000262367	0.987	CREB-binding protein
18	9606.ENSP00000457016	0.987	INO80 complex subunit E
19	9606.ENSP00000318297	0.986	RuvB-like 1
20	9606.ENSP00000336842	0.986	Actin-related protein 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000987	0.999	cis-regulatory region sequence-specific DNA binding
GO:0000981	0.993	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	0.991	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.980	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001227	0.969	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0008134	0.950	transcription factor binding
GO:0140297	0.914	DNA-binding transcription factor binding
GO:0000400	0.711	four-way junction DNA binding
GO:0003723	0.537	RNA binding
GO:0046332	0.507	SMAD binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.995	regulation of metabolic process
GO:0050794	0.992	regulation of cellular process
GO:0080090	0.990	regulation of primary metabolic process
GO:0010468	0.988	regulation of gene expression
GO:0009987	0.978	cellular process
GO:0051171	0.977	regulation of nitrogen compound metabolic process
GO:0031323	0.977	regulation of cellular metabolic process
GO:0009889	0.976	regulation of biosynthetic process
GO:2001141	0.965	regulation of RNA biosynthetic process
GO:1903506	0.958	regulation of nucleic acid-templated transcription
GO:0010558	0.955	negative regulation of macromolecule biosynthetic process
GO:1902679	0.953	negative regulation of RNA biosynthetic process
GO:0009893	0.924	positive regulation of metabolic process
GO:0010604	0.912	positive regulation of macromolecule metabolic process
GO:0045892	0.906	negative regulation of DNA-templated transcription
GO:0048522	0.871	positive regulation of cellular process
GO:0051173	0.862	positive regulation of nitrogen compound metabolic process
GO:0031325	0.850	positive regulation of cellular metabolic process
GO:0006357	0.836	regulation of transcription by RNA polymerase II
GO:0045935	0.830	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.775	positive regulation of macromolecule biosynthetic process
GO:0051254	0.775	positive regulation of RNA metabolic process
GO:0050896	0.774	response to stimulus
GO:0045893	0.767	positive regulation of DNA-templated transcription
GO:0008152	0.731	metabolic process
GO:0043170	0.691	macromolecule metabolic process
GO:0045944	0.676	positive regulation of transcription by RNA polymerase II
GO:0051716	0.673	cellular response to stimulus
GO:0044238	0.660	primary metabolic process
GO:0006807	0.638	nitrogen compound metabolic process
GO:0044237	0.584	cellular metabolic process
GO:0071840	0.537	cellular component organization or biogenesis
GO:0016043	0.500	cellular component organization
GO:0000122	0.482	negative regulation of transcription by RNA polymerase II
GO:0006950	0.437	response to stress
GO:0034641	0.326	cellular nitrogen compound metabolic process
GO:1901360	0.315	organic cyclic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	0.997	nucleoplasm
GO:0005737	0.981	cytoplasm
GO:0043232	0.956	intracellular non-membrane-bounded organelle
GO:0140513	0.912	nuclear protein-containing complex
GO:0000785	0.895	chromatin
GO:0005667	0.771	transcription regulator complex
GO:1902494	0.486	catalytic complex
GO:0070603	0.404	SWI/SNF superfamily-type complex
GO:0000228	0.398	nuclear chromosome
GO:0097346	0.381	INO80-type complex
GO:0031011	0.368	Ino80 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]