StarFunc result for job id P25685

User Input

>input (340 residues)
MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRK
REIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRN
GEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCT
KKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLK
DKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGE
GLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0K030	0.575	0.575	1.869E-67	340	0.959	0.959	B0K030.pdb.gz	B0K030_RAT DnaJ (Hsp40) homolog, subfamily B, member 1 (Predicted), isoform CRA_b OS=Rattus norvegicus OX=10116 GN=Dnajb1 PE=2 SV=1
2	AFDB:B8JM56	0.575	0.575	2.740E-56	340	0.659	0.659	B8JM56.pdb.gz
3	AFDB:A0A0R4IYH3	0.570	0.578	1.499E-54	335	0.679	0.690	A0A0R4IYH3.pdb.gz
4	AFDB:Q9UDY4	0.849	0.856	9.246E-54	337	0.668	0.674	Q9UDY4.pdb.gz	DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens OX=9606 GN=DNAJB4 PE=1 SV=1
5	AFDB:O75953	0.826	0.808	3.730E-53	348	0.653	0.638	O75953.pdb.gz	DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens OX=9606 GN=DNAJB5 PE=1 SV=1
6	AFDB:D3ZUU5	0.724	0.669	9.310E-50	371	0.791	0.725	D3ZUU5.pdb.gz	D3ZUU5_RAT DnaJ heat shock protein family (Hsp40) member B1 OS=Rattus norvegicus OX=10116 GN=Dnajb1 PE=4 SV=1
7	AFDB:Q20774	0.745	0.762	6.922E-46	331	0.524	0.538	Q20774.pdb.gz	Q20774_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-13 PE=1 SV=1
8	AFDB:Q24133	0.541	0.550	1.128E-43	334	0.524	0.533	Q24133.pdb.gz	DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster OX=7227 GN=DnaJ-1 PE=1 SV=3
9	AFDB:P59910	0.531	0.569	1.064E-42	316	0.476	0.513	P59910.pdb.gz	DJB13_HUMAN DnaJ homolog subfamily B member 13 OS=Homo sapiens OX=9606 GN=DNAJB13 PE=1 SV=1
10	AFDB:Q80Y75	0.532	0.571	6.571E-41	316	0.471	0.506	Q80Y75.pdb.gz	DJB13_MOUSE DnaJ homolog subfamily B member 13 OS=Mus musculus OX=10090 GN=Dnajb13 PE=1 SV=1
11	PDB:6byrA	0.196	0.165	1.135E-7	405	0.203	0.170	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:7x3kA	0.182	0.234	7.942E-4	262	0.085	0.111	7x3kA.pdb.gz
13	PDB:2y4uA	0.156	0.126	3.203E-3	424	0.085	0.068	2y4uA.pdb.gz
14	PDB:5y88T	0.158	0.446	8.452E-3	107	0.065	0.206	5y88T.pdb.gz	Structure of an Intron Lariat Spliceosome from Saccharomyces cerevisiae
15	PDB:2l6lA	0.148	0.295	8.467E-2	155	0.071	0.155	2l6lA.pdb.gz	Structure and mechanistic insights into novel iron-mediated moonlighting functions of human J-protein cochaperone, Dph4.
16	PDB:1fpoA	0.167	0.318	8.996E-2	171	0.044	0.088	1fpoA.pdb.gz
17	PDB:7sqcO0	0.147	0.062	3.214E-1	1140	0.074	0.022	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
18	PDB:7sqcO1	0.144	0.094	3.214E-1	673	0.062	0.031	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
19	PDB:2z5bA	0.093	0.175	4.625E-1	127	0.035	0.094	2z5bA.pdb.gz
20	PDB:2uxtA	0.097	0.082	7.513E-1	422	0.047	0.038	2uxtA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0K030	0.0	632	340	0.959	0.959	B0K030_RAT DnaJ (Hsp40) homolog, subfamily B, member 1 (Predicted), isoform CRA_b OS=Rattus norvegicus OX=10116 GN=Dnajb1 PE=2 SV=1
2	D3ZUU5	0.0	556	371	0.788	0.722	D3ZUU5_RAT DnaJ heat shock protein family (Hsp40) member B1 OS=Rattus norvegicus OX=10116 GN=Dnajb1 PE=4 SV=1
3	M0QXK0	0.0	544	273	0.779	0.971	M0QXK0_HUMAN DnaJ heat shock protein family (Hsp40) member B1 OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=2
4	P25685	0.0	694	340	1.000	1.000	DNJB1_HUMAN DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=4
5	Q6FHS4	0.0	694	340	1.000	1.000	Q6FHS4_HUMAN DNAJB1 protein (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB1 PE=2 SV=1
6	Q9QYJ3	0.0	631	340	0.956	0.956	DNJB1_MOUSE DnaJ homolog subfamily B member 1 OS=Mus musculus OX=10090 GN=Dnajb1 PE=1 SV=3
7	Q6DEJ4	6.89e-162	457	335	0.671	0.681	Q6DEJ4_DANRE DnaJ (Hsp40) homolog, subfamily B, member 1 OS=Danio rerio OX=7955 GN=dnajb1 PE=2 SV=1
8	Q7ZVY8	4.36e-161	455	337	0.653	0.659	Q7ZVY8_DANRE DnaJ homolog subfamily B member 1 OS=Danio rerio OX=7955 GN=zgc:55492 PE=1 SV=1
9	Q9UDY4	5.67e-161	455	337	0.665	0.671	DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens OX=9606 GN=DNAJB4 PE=1 SV=1
10	O89114	4.97e-147	420	348	0.635	0.621	DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus OX=10090 GN=Dnajb5 PE=2 SV=1
11	O75953	3.02e-146	418	348	0.629	0.615	DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens OX=9606 GN=DNAJB5 PE=1 SV=1
12	M0R080	2.49e-133	379	183	0.538	1.000	M0R080_HUMAN DnaJ homolog subfamily B member 1 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=1
13	Q24133	5.26e-114	335	334	0.541	0.551	DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster OX=7227 GN=DnaJ-1 PE=1 SV=3
14	Q20774	5.04e-106	315	331	0.518	0.532	Q20774_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-13 PE=1 SV=1
15	P59910	6.70e-103	306	316	0.482	0.519	DJB13_HUMAN DnaJ homolog subfamily B member 13 OS=Homo sapiens OX=9606 GN=DNAJB13 PE=1 SV=1
16	Q80Y75	3.43e-100	300	316	0.476	0.513	DJB13_MOUSE DnaJ homolog subfamily B member 13 OS=Mus musculus OX=10090 GN=Dnajb13 PE=1 SV=1
17	M0QYT3	2.72e-80	242	116	0.341	1.000	M0QYT3_HUMAN DnaJ homolog subfamily B member 1 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=1
18	M0QZD0	1.01e-72	222	107	0.315	1.000	M0QZD0_HUMAN DnaJ homolog subfamily B member 1 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=1
19	O96212	2.01e-72	229	328	0.406	0.421	O96212_PLAF7 Protein SIS1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0213100 PE=4 SV=1
20	Q8I489	2.40e-68	221	402	0.379	0.321	Q8I489_PLAF7 Heat shock protein 40, type II OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0501100.1 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00226 DnaJ	7.3e-24	95.0	DnaJ domain
2	PF01556 DnaJ_C	5.8e-41	151.5	DnaJ C terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254322

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302961	0.999	Heat shock protein family A member 4
2	9606.ENSP00000335153	0.999	Heat shock protein HSP 90-alpha
3	9606.ENSP00000432083	0.999	Heat shock cognate 71 kDa protein
4	9606.ENSP00000351646	0.995	Stress-induced-phosphoprotein 1
5	9606.ENSP00000360609	0.992	Heat shock protein HSP 90-beta
6	9606.ENSP00000296464	0.991	Heat shock 70 kDa protein 4L
7	9606.ENSP00000324173	0.991	78 kDa glucose-regulated protein
8	9606.ENSP00000364802	0.991	Heat shock 70 kDa protein 1A
9	9606.ENSP00000310219	0.990	Heat shock 70 kDa protein 6
10	9606.ENSP00000297185	0.988	Stress-70 protein, mitochondrial
11	9606.ENSP00000318687	0.987	Heat shock protein 105 kDa
12	9606.ENSP00000367623	0.982	Heat shock 70 kDa protein 14
13	9606.ENSP00000431512	0.973	Heat shock factor protein 1
14	9606.ENSP00000254436	0.971	E3 ubiquitin-protein ligase TRIM21
15	9606.ENSP00000281938	0.966	Heat shock protein beta-8
16	9606.ENSP00000285667	0.966	Heat shock 70 kDa protein 13
17	9606.ENSP00000433560	0.958	Alpha-crystallin B chain
18	9606.ENSP00000264954	0.957	GrpE protein homolog 1, mitochondrial
19	9606.ENSP00000278483	0.955	Protein Hikeshi
20	9606.ENSP00000364801	0.950	Heat shock protein family A member 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051087	0.999	chaperone binding
GO:0098772	0.997	molecular function regulator activity
GO:0140677	0.970	molecular function activator activity
GO:0060590	0.909	ATPase regulator activity
GO:0001671	0.897	ATPase activator activity
GO:0051082	0.773	unfolded protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.955	cellular process
GO:0006457	0.924	protein folding
GO:0065007	0.916	biological regulation
GO:0050789	0.903	regulation of biological process
GO:0050794	0.891	regulation of cellular process
GO:0050896	0.781	response to stimulus
GO:0061077	0.774	chaperone-mediated protein folding
GO:0006458	0.769	'de novo' protein folding
GO:0019222	0.739	regulation of metabolic process
GO:0051084	0.696	'de novo' post-translational protein folding
GO:0060255	0.655	regulation of macromolecule metabolic process
GO:0051171	0.516	regulation of nitrogen compound metabolic process
GO:0042221	0.489	response to chemical
GO:0032501	0.482	multicellular organismal process
GO:0031323	0.481	regulation of cellular metabolic process
GO:0048519	0.478	negative regulation of biological process
GO:0080090	0.477	regulation of primary metabolic process
GO:0006950	0.473	response to stress
GO:0010033	0.467	response to organic substance
GO:0048523	0.457	negative regulation of cellular process
GO:0010468	0.426	regulation of gene expression
GO:0032502	0.399	developmental process
GO:0048518	0.399	positive regulation of biological process
GO:0009889	0.392	regulation of biosynthetic process
GO:0048856	0.377	anatomical structure development
GO:0031326	0.359	regulation of cellular biosynthetic process
GO:0051716	0.357	cellular response to stimulus
GO:0010556	0.352	regulation of macromolecule biosynthetic process
GO:0008152	0.332	metabolic process
GO:0007275	0.329	multicellular organism development
GO:0048583	0.317	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.998	cytosol
GO:1903561	0.607	extracellular vesicle
GO:0070062	0.596	extracellular exosome
GO:0032991	0.405	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]