StarFunc result for job id P25686

User Input

>input (324 residues)
MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKH
KREIYDRYGREGLTGTGTGPSRAEAGSGGPGFTFTFRSPEEVFREFFGSGDPFAELFDDL
GPFSELQNRGSRHSGPFFTFSSSFPGHSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRIT
TRRIMENGQERVEVEEDGQLKSVTINGVPDDLALGLELSRREQQPSVTSRSGGTQVQQTP
ASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQHRRQGRPKAQHQDPGLGGTQ
EGARGEATKRSPSPEEKASRCLIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P25686	0.999	0.999	1.298E-51	324	1.000	1.000	P25686.pdb.gz	DNJB2_HUMAN DnaJ homolog subfamily B member 2 OS=Homo sapiens OX=9606 GN=DNAJB2 PE=1 SV=3
2	AFDB:A0A0J9YX62	0.492	0.478	4.858E-26	334	0.460	0.446	A0A0J9YX62.pdb.gz	A0A0J9YX62_HUMAN DnaJ heat shock protein family (Hsp40) member B6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
3	AFDB:O54946	0.468	0.420	2.517E-25	365	0.463	0.411	O54946.pdb.gz	DNJB6_MOUSE DnaJ homolog subfamily B member 6 OS=Mus musculus OX=10090 GN=Dnajb6 PE=1 SV=4
4	AFDB:Q6DHR2	0.444	0.454	8.012E-24	316	0.441	0.453	Q6DHR2.pdb.gz	Q6DHR2_DANRE DnaJ heat shock protein family (Hsp40) member B6a OS=Danio rerio OX=7955 GN=zgc:92148 PE=1 SV=1
5	AFDB:A0A1D5NSC8	0.412	0.427	1.064E-23	311	0.423	0.441	A0A1D5NSC8.pdb.gz
6	AFDB:Q7Z6W7	0.489	0.511	5.278E-20	309	0.346	0.362	Q7Z6W7.pdb.gz	DNJB7_HUMAN DnaJ homolog subfamily B member 7 OS=Homo sapiens OX=9606 GN=DNAJB7 PE=2 SV=2
7	AFDB:O35723	0.386	0.500	8.309E-20	242	0.377	0.504	O35723.pdb.gz	DNJB3_MOUSE DnaJ homolog subfamily B member 3 OS=Mus musculus OX=10090 GN=Dnajb3 PE=2 SV=1
8	AFDB:Q8NHS0	0.297	0.405	2.735E-19	232	0.355	0.496	Q8NHS0.pdb.gz	DNJB8_HUMAN DnaJ homolog subfamily B member 8 OS=Homo sapiens OX=9606 GN=DNAJB8 PE=1 SV=1
9	AFDB:Q7KQK3	0.305	0.398	1.285E-10	244	0.231	0.307	Q7KQK3.pdb.gz	Q7KQK3_PLAF7 Heat shock protein DNAJ homologue Pfj4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1211400 PE=4 SV=1
10	AFDB:E9PH18	0.320	0.480	1.524E-10	211	0.302	0.464	E9PH18.pdb.gz	E9PH18_HUMAN DnaJ heat shock protein family (Hsp40) member B6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
11	PDB:6byrA	0.199	0.160	6.194E-4	405	0.167	0.133	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:5y88T	0.163	0.436	1.211E-1	107	0.065	0.196	5y88T.pdb.gz	Structure of an Intron Lariat Spliceosome from Saccharomyces cerevisiae
13	PDB:7x3kA	0.194	0.238	1.436E-1	262	0.077	0.095	7x3kA.pdb.gz
14	PDB:1fpoA	0.180	0.330	2.392E-1	171	0.037	0.070	1fpoA.pdb.gz
15	PDB:2k8pA	0.089	0.135	3.766E-1	189	0.052	0.090	2k8pA.pdb.gz
16	PDB:7qooP	0.090	0.118	8.334E-1	233	0.037	0.052	7qooP.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
17	PDB:4wspA	0.104	0.370	8.820E-1	79	0.046	0.190	4wspA.pdb.gz
18	PDB:2l3aA	0.097	0.242	9.335E-1	82	0.022	0.085	2l3aA.pdb.gz
19	PDB:4fhmA	0.096	0.089	1.171	354	0.012	0.011	4fhmA.pdb.gz
20	PDB:3tkpA	0.066	0.070	1.240	197	0.031	0.051	3tkpA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P25686	0.0	657	324	1.000	1.000	DNJB2_HUMAN DnaJ homolog subfamily B member 2 OS=Homo sapiens OX=9606 GN=DNAJB2 PE=1 SV=3
2	C9JRD2	1.48e-166	464	228	0.704	1.000	C9JRD2_HUMAN DnaJ heat shock protein family (Hsp40) member B2 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB2 PE=1 SV=1
3	Q7ZW83	3.29e-66	209	237	0.392	0.536	Q7ZW83_DANRE DnaJ (Hsp40) homolog, subfamily B, member 6 OS=Danio rerio OX=7955 GN=dnajb6 PE=2 SV=1
4	O54946	1.03e-65	213	365	0.404	0.359	DNJB6_MOUSE DnaJ homolog subfamily B member 6 OS=Mus musculus OX=10090 GN=Dnajb6 PE=1 SV=4
5	O75190	2.24e-63	205	326	0.466	0.463	DNJB6_HUMAN DnaJ homolog subfamily B member 6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=2
6	A0A0J9YX62	3.09e-63	205	334	0.414	0.401	A0A0J9YX62_HUMAN DnaJ heat shock protein family (Hsp40) member B6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
7	C9J2C4	1.33e-56	184	228	0.380	0.539	C9J2C4_HUMAN DnaJ heat shock protein family (Hsp40) member B6 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
8	O35723	6.85e-56	183	242	0.355	0.475	DNJB3_MOUSE DnaJ homolog subfamily B member 3 OS=Mus musculus OX=10090 GN=Dnajb3 PE=2 SV=1
9	Q8NHS0	2.58e-55	181	232	0.352	0.491	DNJB8_HUMAN DnaJ homolog subfamily B member 8 OS=Homo sapiens OX=9606 GN=DNAJB8 PE=1 SV=1
10	Q7Z6W7	1.79e-51	174	309	0.340	0.356	DNJB7_HUMAN DnaJ homolog subfamily B member 7 OS=Homo sapiens OX=9606 GN=DNAJB7 PE=2 SV=2
11	Q6DHR2	7.60e-45	157	316	0.241	0.247	Q6DHR2_DANRE DnaJ heat shock protein family (Hsp40) member B6a OS=Danio rerio OX=7955 GN=zgc:92148 PE=1 SV=1
12	E9PH18	5.88e-36	130	211	0.235	0.360	E9PH18_HUMAN DnaJ heat shock protein family (Hsp40) member B6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
13	Q80ZP0	5.92e-30	115	234	0.262	0.363	Q80ZP0_MOUSE 4930503B20Rik protein OS=Mus musculus OX=10090 GN=4930503B20Rik PE=2 SV=1
14	G5E8V6	1.28e-29	115	231	0.262	0.368	G5E8V6_MOUSE RIKEN cDNA 4930503B20 gene OS=Mus musculus OX=10090 GN=4930503B20Rik PE=4 SV=1
15	Q9TY07	3.75e-29	114	249	0.281	0.365	Q9TY07_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-24 PE=4 SV=3
16	Q6DEJ4	3.79e-26	108	335	0.182	0.176	Q6DEJ4_DANRE DnaJ (Hsp40) homolog, subfamily B, member 1 OS=Danio rerio OX=7955 GN=dnajb1 PE=2 SV=1
17	O76224	9.03e-25	104	336	0.188	0.182	O76224_9TRYP Chaperone OS=Trypanosoma brucei OX=5691 GN=DNAJ PE=4 SV=1
18	Q38AB7	9.03e-25	104	336	0.188	0.182	Q38AB7_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2000 PE=4 SV=1
19	Q7KQK3	1.35e-24	102	244	0.216	0.287	Q7KQK3_PLAF7 Heat shock protein DNAJ homologue Pfj4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1211400 PE=4 SV=1
20	Q24133	2.38e-24	103	334	0.179	0.174	DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster OX=7227 GN=DnaJ-1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00226 DnaJ	2.3e-23	93.4	DnaJ domain
2	PF13446 RPT	4.3e+02	12.3	A repeated domain in UCH-protein
3	PF02809 UIM	3.1	18.9	Ubiquitin interaction motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010358604.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010358263.1	0.923	Heat shock 70 kDa protein 4
2	61622.XP_010373342.1	0.834	Heat shock 70 kDa protein 4L isoform X1
3	61622.XP_010365374.1	0.820	Heat shock protein family H (Hsp110) member 1
4	61622.XP_010386405.1	0.795	Heat shock protein family A (Hsp70) member 9
5	61622.XP_010381641.1	0.790	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 786 ESTs, 93 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments
6	61622.XP_010374587.1	0.789	Heat shock 70 kDa protein 1-like
7	61622.XP_010354893.1	0.745	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 2 bases in 1 codon
8	61622.XP_010357806.1	0.745	Heat shock 70 kDa protein 1-like
9	61622.XP_010364166.1	0.745	Heat shock protein family A (Hsp70) member 5
10	61622.XP_010381642.1	0.745	Heat shock 70 kDa protein 1-like
11	61622.XP_010354757.1	0.744	Belongs to the heat shock protein 70 family.
12	61622.XP_010357593.1	0.740	Heat shock 70 kDa protein-like
13	61622.XP_010357616.1	0.739	Heat shock 70 kDa protein cognate 4
14	61622.XP_010364270.1	0.739	Heat shock 70 kDa protein 14 isoform X1
15	61622.XP_010373900.1	0.739	Belongs to the heat shock protein 70 family.
16	61622.XP_010357579.1	0.736	Heat shock 70 kDa protein cognate 4-like
17	61622.XP_010382001.1	0.734	Heat shock-related 70 kDa protein 2
18	61622.XP_010358686.1	0.696	Heat shock 70 kDa protein 13 isoform X1
19	61622.XP_010376844.1	0.663	DnaJ heat shock protein family (Hsp40) member A1
20	61622.XP_010376956.1	0.660	DnaJ heat shock protein family (Hsp40) member A4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070628	1.000	proteasome binding
GO:0051087	1.000	chaperone binding
GO:0043130	1.000	ubiquitin binding
GO:0031593	1.000	polyubiquitin modification-dependent protein binding
GO:0001671	1.000	ATPase activator activity
GO:0031625	0.998	ubiquitin protein ligase binding
GO:0030544	0.997	Hsp70 protein binding
GO:0051082	0.996	unfolded protein binding
GO:0140035	0.996	ubiquitination-like modification-dependent protein binding
GO:0140036	0.534	ubiquitin-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0065007	0.985	biological regulation
GO:0050794	0.983	regulation of cellular process
GO:0050896	0.958	response to stimulus
GO:0006950	0.944	response to stress
GO:0006457	0.889	protein folding
GO:0044237	0.886	cellular metabolic process
GO:0030163	0.873	protein catabolic process
GO:0060255	0.870	regulation of macromolecule metabolic process
GO:0010498	0.862	proteasomal protein catabolic process
GO:0060341	0.859	regulation of cellular localization
GO:0048519	0.847	negative regulation of biological process
GO:0048518	0.842	positive regulation of biological process
GO:0080090	0.819	regulation of primary metabolic process
GO:0034976	0.811	response to endoplasmic reticulum stress
GO:0051171	0.806	regulation of nitrogen compound metabolic process
GO:0048523	0.800	negative regulation of cellular process
GO:0009894	0.798	regulation of catabolic process
GO:0051246	0.777	regulation of protein metabolic process
GO:0036503	0.777	ERAD pathway
GO:0043161	0.762	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0030162	0.752	regulation of proteolysis
GO:0051128	0.747	regulation of cellular component organization
GO:0061077	0.732	chaperone-mediated protein folding
GO:0042176	0.730	regulation of protein catabolic process
GO:1903320	0.727	regulation of protein modification by small protein conjugation or removal
GO:0030433	0.722	ubiquitin-dependent ERAD pathway
GO:0031323	0.721	regulation of cellular metabolic process
GO:0009892	0.721	negative regulation of metabolic process
GO:0031329	0.710	regulation of cellular catabolic process
GO:0061136	0.680	regulation of proteasomal protein catabolic process
GO:0050790	0.671	regulation of catalytic activity
GO:2000058	0.664	regulation of ubiquitin-dependent protein catabolic process
GO:0010605	0.662	negative regulation of macromolecule metabolic process
GO:0048522	0.646	positive regulation of cellular process
GO:0044087	0.617	regulation of cellular component biogenesis
GO:0051248	0.603	negative regulation of protein metabolic process
GO:0051129	0.599	negative regulation of cellular component organization
GO:0032880	0.594	regulation of protein localization
GO:0031396	0.572	regulation of protein ubiquitination
GO:0009893	0.563	positive regulation of metabolic process
GO:0035966	0.560	response to topologically incorrect protein
GO:0045861	0.544	negative regulation of proteolysis
GO:0032434	0.534	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0010604	0.474	positive regulation of macromolecule metabolic process
GO:0051173	0.458	positive regulation of nitrogen compound metabolic process
GO:0044092	0.436	negative regulation of molecular function
GO:0071840	0.368	cellular component organization or biogenesis
GO:0006986	0.360	response to unfolded protein
GO:0031325	0.335	positive regulation of cellular metabolic process
GO:0016043	0.322	cellular component organization
GO:0051098	0.315	regulation of binding
GO:0044093	0.301	positive regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0005634	0.996	nucleus
GO:0012505	0.991	endomembrane system
GO:0016020	0.990	membrane
GO:0031974	0.920	membrane-enclosed lumen
GO:0070013	0.914	intracellular organelle lumen
GO:0032991	0.895	protein-containing complex
GO:0031090	0.883	organelle membrane
GO:0005783	0.762	endoplasmic reticulum
GO:0031981	0.759	nuclear lumen
GO:0031967	0.743	organelle envelope
GO:0005654	0.732	nucleoplasm
GO:0005635	0.470	nuclear envelope
GO:0031984	0.412	organelle subcompartment
GO:0042175	0.399	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.392	endoplasmic reticulum membrane
GO:1902494	0.381	catalytic complex
GO:0042406	0.365	extrinsic component of endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]