StarFunc result for job id P25705

User Input

>input (553 residues)
MLSVRVAAAVVRALPRRAGLVSRNALGSSFIAARNFHASNTHLQKTGTAEMSSILEERIL
GADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFG
NDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGII
PRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKK
KLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF
RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFG
GGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSA
AQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMA
IEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVVSQHQALLGTIRADGKISEQSDAKL
KEIVTNFLAGFEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P15999	0.935	0.935	0.000	553	0.967	0.967	P15999.pdb.gz	ATPA_RAT ATP synthase subunit alpha, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5f1a PE=1 SV=2
2	AFDB:P35381	0.926	0.927	4.732E-94	552	0.814	0.815	P35381.pdb.gz	ATPA_DROME ATP synthase subunit alpha, mitochondrial OS=Drosophila melanogaster OX=7227 GN=blw PE=1 SV=2
3	AFDB:Q9XXK1	0.927	0.953	5.334E-93	538	0.767	0.788	Q9XXK1.pdb.gz	ATPA_CAEEL ATP synthase subunit alpha, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=atp-1 PE=1 SV=1
4	AFDB:P24487	0.914	0.942	1.878E-87	536	0.671	0.692	P24487.pdb.gz	ATPA_SCHPO ATP synthase subunit alpha, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atp1 PE=3 SV=1
5	AFDB:A0A1D8PDC4	0.905	0.916	3.083E-87	546	0.684	0.692	A0A1D8PDC4.pdb.gz	A0A1D8PDC4_CANAL ATP synthase subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATP1 PE=3 SV=1
6	PDB:2wssA	0.905	0.981	6.614E-87	510	0.910	0.986	2wssA.pdb.gz	The Structure of the Membrane Extrinsic Region of Bovine ATP Synthase
7	AFDB:G8B7R3	0.914	0.924	1.521E-86	547	0.669	0.676	G8B7R3.pdb.gz	G8B7R3_CANPC ATP synthase subunit alpha OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=ATP1 PE=3 SV=1
8	AFDB:P07251	0.912	0.925	6.726E-86	545	0.687	0.697	P07251.pdb.gz	ATPA_YEAST ATP synthase subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP1 PE=1 SV=5
9	AFDB:Q6FJ33	0.911	0.928	2.814E-85	543	0.676	0.689	Q6FJ33.pdb.gz	Q6FJ33_CANGA ATP synthase subunit alpha OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ATP1 PE=3 SV=1
10	AFDB:P05036	0.909	0.985	7.313E-83	510	0.638	0.692	P05036.pdb.gz	ATPA_RHORU ATP synthase subunit alpha OS=Rhodospirillum rubrum OX=1085 GN=atpA PE=1 SV=1
11	AFDB:F4IMB5	0.846	0.605	2.575E-77	777	0.620	0.441	F4IMB5.pdb.gz	F4IMB5_ARATH ATP synthase subunit alpha, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g07698 PE=1 SV=1
12	PDB:6cp3C	0.904	0.983	6.348E-74	508	0.676	0.736	6cp3C.pdb.gz	High-resolution cryo-EM analysis of the yeast ATP synthase in a lipid membrane.
13	PDB:6oqsB	0.845	0.909	2.100E-63	513	0.523	0.563	6oqsB.pdb.gz	Cryo-EM structures provide insight into how E. coli F1FoATP synthase accommodates symmetry mismatch.
14	PDB:6f5dA	0.800	0.843	5.521E-54	524	0.410	0.433	6f5dA.pdb.gz	ATP synthase fromTrypanosoma bruceihas an elaborated canonical F1-domain and conventional catalytic sites.
15	PDB:6f5dF	0.709	0.798	6.325E-34	488	0.186	0.211	6f5dF.pdb.gz	ATP synthase fromTrypanosoma bruceihas an elaborated canonical F1-domain and conventional catalytic sites.
16	PDB:2wpdE	0.688	0.794	1.294E-33	473	0.186	0.218	2wpdE.pdb.gz	Crystal Structure of the Mg.Adp-Inhibited State of the Yeast F1C10-ATP Synthase.
17	PDB:5b0oB	0.685	0.824	9.918E-33	455	0.175	0.213	5b0oB.pdb.gz	Insight into the flagella type III export revealed by the complex structure of the type III ATPase and its regulator
18	PDB:5ze9F	0.670	0.802	2.823E-32	456	0.201	0.243	5ze9F.pdb.gz	Metastable asymmetrical structure of a shaftless V1motor.
19	PDB:7valF	0.691	0.805	5.172E-32	471	0.166	0.195	7valF.pdb.gz	Structural snapshots of V/A-ATPase reveal the rotary catalytic mechanism of rotary ATPases.
20	PDB:7l1qF	0.701	0.815	1.001E-31	471	0.201	0.236	7l1qF.pdb.gz	The six steps of the complete F 1 -ATPase rotary catalytic cycle.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PDC4	773	546	0.660	0.668	A0A1D8PDC4_CANAL ATP synthase subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATP1 PE=3 SV=1
2	F4IMB5	701	777	0.626	0.445	F4IMB5_ARATH ATP synthase subunit alpha, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g07698 PE=1 SV=1
3	G8B7R3	761	547	0.651	0.658	G8B7R3_CANPC ATP synthase subunit alpha OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=ATP1 PE=3 SV=1
4	O96252	640	551	0.564	0.566	O96252_PLAF7 ATP synthase subunit alpha OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0217100 PE=3 SV=1
5	P05036	727	510	0.638	0.692	ATPA_RHORU ATP synthase subunit alpha OS=Rhodospirillum rubrum OX=1085 GN=atpA PE=1 SV=1
6	P05494	717	508	0.640	0.697	ATPAM_MAIZE ATP synthase subunit alpha, mitochondrial OS=Zea mays OX=4577 GN=ATPA PE=3 SV=1
7	P07251	776	545	0.676	0.686	ATPA_YEAST ATP synthase subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP1 PE=1 SV=5
8	P0ABB0	560	513	0.524	0.565	ATPA_ECOLI ATP synthase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=atpA PE=1 SV=1
9	P0C2Z4	577	507	0.528	0.576	ATPA_ORYSA ATP synthase subunit alpha, chloroplastic OS=Oryza sativa OX=4530 GN=atpA PE=3 SV=1
10	P0C2Z5	577	507	0.528	0.576	ATPA_ORYSI ATP synthase subunit alpha, chloroplastic OS=Oryza sativa subsp. indica OX=39946 GN=atpA PE=3 SV=1
11	P0C2Z6	577	507	0.528	0.576	ATPA_ORYSJ ATP synthase subunit alpha, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=atpA PE=3 SV=1
12	P0C520	718	509	0.640	0.695	ATPAM_ORYSA ATP synthase subunit alpha, mitochondrial OS=Oryza sativa OX=4530 GN=ATPA PE=3 SV=1
13	P0C521	718	509	0.640	0.695	ATPAM_ORYSI ATP synthase subunit alpha, mitochondrial OS=Oryza sativa subsp. indica OX=39946 GN=ATPA PE=3 SV=1
14	P0C522	718	509	0.640	0.695	ATPAM_ORYSJ ATP synthase subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=ATPA PE=1 SV=1
15	P15999	1089	553	0.967	0.967	ATPA_RAT ATP synthase subunit alpha, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5f1a PE=1 SV=2
16	P19483	1095	553	0.976	0.976	ATPA_BOVIN ATP synthase subunit alpha, mitochondrial OS=Bos taurus OX=9913 GN=ATP5F1A PE=1 SV=1
17	P24487	777	536	0.665	0.687	ATPA_SCHPO ATP synthase subunit alpha, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atp1 PE=3 SV=1
18	P25705	1117	553	1.000	1.000	ATPA_HUMAN ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A PE=1 SV=1
19	P27179	611	503	0.544	0.598	ATPA_SYNY3 ATP synthase subunit alpha OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=atpA PE=3 SV=1
20	P35381	909	552	0.814	0.815	ATPA_DROME ATP synthase subunit alpha, mitochondrial OS=Drosophila melanogaster OX=7227 GN=blw PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00006 ATP-synt_ab	1.2e-69	245.8	ATP synthase alpha/beta family, nucleotide-binding domain
2	PF00306 ATP-synt_ab_C	3.3e-44	161.7	ATP synthase alpha/beta chain, C terminal domain
3	PF02874 ATP-synt_ab_N	2.2e-13	61.8	ATP synthase alpha/beta family, beta-barrel domain
4	PF13628 DUF4142	3.1	19.5	Domain of unknown function (DUF4142)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381736

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215375	0.999	ATP synthase subunit delta, mitochondrial
2	9606.ENSP00000243997	0.999	ATP synthase subunit epsilon, mitochondrial
3	9606.ENSP00000262030	0.999	ATP synthase subunit beta, mitochondrial
4	9606.ENSP00000290299	0.999	ATP synthase subunit O, mitochondrial
5	9606.ENSP00000292475	0.999	ATP synthase subunit f, mitochondrial
6	9606.ENSP00000301587	0.999	ATP synthase subunit d, mitochondrial
7	9606.ENSP00000306003	0.999	ATP synthase subunit e, mitochondrial
8	9606.ENSP00000349142	0.999	ATP synthase subunit gamma, mitochondrial
9	9606.ENSP00000354632	0.999	ATP synthase subunit a
10	9606.ENSP00000358737	0.999	ATP synthase F(0) complex subunit B1, mitochondrial
11	9606.ENSP00000300688	0.998	ATP synthase subunit g, mitochondrial
12	9606.ENSP00000389649	0.998	ATP synthase-coupling factor 6, mitochondrial
13	9606.ENSP00000377033	0.997	ATP synthase F(0) complex subunit C1, mitochondrial
14	9606.ENSP00000284727	0.995	ATP synthase F(0) complex subunit C3, mitochondrial
15	9606.ENSP00000317159	0.994	Cytochrome c1, heme protein, mitochondrial
16	9606.ENSP00000355265	0.990	ATP synthase protein 8
17	9606.ENSP00000268379	0.989	Cytochrome b-c1 complex subunit 2, mitochondrial
18	9606.ENSP00000342056	0.989	Citrate synthase, mitochondrial
19	9606.ENSP00000216254	0.986	Aconitate hydratase, mitochondrial
20	9606.ENSP00000281456	0.983	ADP/ATP translocase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0097159	0.979	organic cyclic compound binding
GO:1901363	0.973	heterocyclic compound binding
GO:0003824	0.965	catalytic activity
GO:0043167	0.879	ion binding
GO:0005215	0.551	transporter activity
GO:0022857	0.519	transmembrane transporter activity
GO:0015078	0.470	proton transmembrane transporter activity
GO:0003723	0.392	RNA binding
GO:0140657	0.352	ATP-dependent activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.982	organic substance metabolic process
GO:0044237	0.981	cellular metabolic process
GO:0044238	0.979	primary metabolic process
GO:0006807	0.822	nitrogen compound metabolic process
GO:0055086	0.783	nucleobase-containing small molecule metabolic process
GO:0009144	0.744	purine nucleoside triphosphate metabolic process
GO:1901564	0.739	organonitrogen compound metabolic process
GO:0072521	0.623	purine-containing compound metabolic process
GO:1901135	0.616	carbohydrate derivative metabolic process
GO:0009117	0.586	nucleotide metabolic process
GO:0006163	0.480	purine nucleotide metabolic process
GO:0009150	0.447	purine ribonucleotide metabolic process
GO:1901576	0.431	organic substance biosynthetic process
GO:0044249	0.424	cellular biosynthetic process
GO:0065007	0.410	biological regulation
GO:0044271	0.371	cellular nitrogen compound biosynthetic process
GO:0050789	0.359	regulation of biological process
GO:1901566	0.351	organonitrogen compound biosynthetic process
GO:0050794	0.347	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.998	membrane
GO:0032991	0.996	protein-containing complex
GO:0031090	0.960	organelle membrane
GO:0098796	0.954	membrane protein complex
GO:0070013	0.949	intracellular organelle lumen
GO:0098798	0.943	mitochondrial protein-containing complex
GO:1902494	0.942	catalytic complex
GO:0019866	0.940	organelle inner membrane
GO:0005743	0.930	mitochondrial inner membrane
GO:0045259	0.913	proton-transporting ATP synthase complex
GO:0098800	0.885	inner mitochondrial membrane protein complex
GO:0005753	0.644	mitochondrial proton-transporting ATP synthase complex
GO:0005634	0.557	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]