StarFunc result for job id P25791

User Input

>input (158 residues)
MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLC
GCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECF
KCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P25791	1.000	1.000	1.558E-36	158	1.000	1.000	P25791.pdb.gz	RBTN2_HUMAN Rhombotin-2 OS=Homo sapiens OX=9606 GN=LMO2 PE=1 SV=1
2	AFDB:Q9PTJ3	0.955	0.949	2.318E-33	159	0.899	0.893	Q9PTJ3.pdb.gz	RBTN2_DANRE Rhombotin-2 OS=Danio rerio OX=7955 GN=lmo2 PE=2 SV=1
3	PDB:4kfzB	0.478	0.502	1.814E-26	148	0.937	1.000	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
4	AFDB:A9ED79	0.798	0.807	1.369E-21	156	0.475	0.481	A9ED79.pdb.gz	A9ED79_PIG LIM domain only 1 OS=Sus scrofa OX=9823 GN=LMO1 PE=2 SV=1
5	AFDB:Q8AW92	0.665	0.623	2.161E-19	171	0.392	0.363	Q8AW92.pdb.gz	LMO4A_XENLA LIM domain transcription factor LMO4-A OS=Xenopus laevis OX=8355 GN=lmo4-a PE=1 SV=1
6	AFDB:A9ED84	0.746	0.806	3.174E-19	145	0.487	0.531	A9ED84.pdb.gz	A9ED84_PIG LIM domain only 3 OS=Sus scrofa OX=9823 GN=LMO3 PE=1 SV=1
7	AFDB:Q8IQX7	0.609	0.289	1.006E-18	384	0.449	0.185	Q8IQX7.pdb.gz	Q8IQX7_DROME Beadex, isoform B OS=Drosophila melanogaster OX=7227 GN=Bx PE=1 SV=1
8	AFDB:Q8QG63	0.643	0.614	1.006E-18	167	0.354	0.335	Q8QG63.pdb.gz	Q8QG63_DANRE LIM domain only 4 OS=Danio rerio OX=7955 GN=lmo4 PE=1 SV=1
9	AFDB:Q9VL21	0.658	0.464	2.314E-18	241	0.367	0.241	Q9VL21.pdb.gz	Q9VL21_DROME LD11652p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5708 PE=1 SV=2
10	AFDB:M9PHX4	0.679	0.317	2.467E-18	383	0.481	0.198	M9PHX4.pdb.gz	M9PHX4_DROME Beadex, isoform F OS=Drosophila melanogaster OX=7227 GN=Bx PE=1 SV=2
11	AFDB:P61968	0.647	0.624	1.397E-16	165	0.386	0.370	P61968.pdb.gz	LMO4_HUMAN LIM domain transcription factor LMO4 OS=Homo sapiens OX=9606 GN=LMO4 PE=1 SV=1
12	PDB:1b8tA	0.332	0.278	4.288E-4	192	0.171	0.141	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:1imlA	0.307	0.559	8.748E-2	76	0.108	0.224	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
14	PDB:6tdaL	0.157	0.050	1.376	596	0.082	0.022	6tdaL.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
15	PDB:7a1gM	0.134	0.348	1.467	53	0.051	0.151	7a1gM.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
16	PDB:7uhyD	0.206	0.128	1.564	288	0.063	0.035	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
17	PDB:5dkaA	0.167	0.261	1.667	96	0.089	0.146	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
18	PDB:7uhyA	0.089	0.031	1.895	771	0.089	0.018	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
19	PDB:7uhyC	0.216	0.076	2.297	578	0.089	0.024	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
20	PDB:2jr7A	0.094	0.154	2.449	84	0.038	0.071	2jr7A.pdb.gz	Solution structure of human DESR1, a CSL zinc-binding protein

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P25791	3.32e-115	324	158	1.000	1.000	RBTN2_HUMAN Rhombotin-2 OS=Homo sapiens OX=9606 GN=LMO2 PE=1 SV=1
2	P25801	1.49e-114	322	158	0.994	0.994	RBTN2_MOUSE Rhombotin-2 OS=Mus musculus OX=10090 GN=Lmo2 PE=1 SV=1
3	Q90XH3	2.70e-110	311	158	0.949	0.949	RBTN2_XENLA Rhombotin-2 OS=Xenopus laevis OX=8355 GN=lmo2 PE=2 SV=1
4	Q9PTJ3	5.55e-107	303	159	0.899	0.893	RBTN2_DANRE Rhombotin-2 OS=Danio rerio OX=7955 GN=lmo2 PE=2 SV=1
5	P25800	1.28e-49	158	156	0.475	0.481	RBTN1_HUMAN Rhombotin-1 OS=Homo sapiens OX=9606 GN=LMO1 PE=1 SV=1
6	Q924W9	4.89e-49	157	156	0.475	0.481	RBTN1_MOUSE Rhombotin-1 OS=Mus musculus OX=10090 GN=Lmo1 PE=2 SV=1
7	A9ED79	1.76e-48	155	156	0.468	0.474	A9ED79_PIG LIM domain only 1 OS=Sus scrofa OX=9823 GN=LMO1 PE=2 SV=1
8	A9ED84	2.18e-48	155	145	0.462	0.503	A9ED84_PIG LIM domain only 3 OS=Sus scrofa OX=9823 GN=LMO3 PE=1 SV=1
9	Q8TAP4	2.18e-48	155	145	0.462	0.503	LMO3_HUMAN LIM domain only protein 3 OS=Homo sapiens OX=9606 GN=LMO3 PE=1 SV=1
10	P91608	6.14e-45	150	266	0.443	0.263	P91608_DROSP Dttg protein OS=Drosophila sp. OX=7242 GN=dttg PE=2 SV=1
11	M9PHX4	6.53e-45	153	383	0.443	0.183	M9PHX4_DROME Beadex, isoform F OS=Drosophila melanogaster OX=7227 GN=Bx PE=1 SV=2
12	O77284	1.81e-44	150	313	0.443	0.224	O77284_DROME Beadex, isoform A OS=Drosophila melanogaster OX=7227 GN=Bx PE=1 SV=1
13	Q8IQX7	1.25e-43	149	384	0.443	0.182	Q8IQX7_DROME Beadex, isoform B OS=Drosophila melanogaster OX=7227 GN=Bx PE=1 SV=1
14	M9PI02	3.30e-43	149	424	0.443	0.165	M9PI02_DROME Beadex, isoform D OS=Drosophila melanogaster OX=7227 GN=Bx PE=1 SV=1
15	Q8AW92	5.52e-39	132	171	0.386	0.357	LMO4A_XENLA LIM domain transcription factor LMO4-A OS=Xenopus laevis OX=8355 GN=lmo4-a PE=1 SV=1
16	A0A2R8RLI6	1.97e-37	127	166	0.354	0.337	A0A2R8RLI6_DANRE LIM domain only 4a OS=Danio rerio OX=7955 GN=NH13 PE=1 SV=1
17	Q8QG63	2.19e-37	127	167	0.354	0.335	Q8QG63_DANRE LIM domain only 4 OS=Danio rerio OX=7955 GN=lmo4 PE=1 SV=1
18	P61968	5.09e-37	126	165	0.373	0.358	LMO4_HUMAN LIM domain transcription factor LMO4 OS=Homo sapiens OX=9606 GN=LMO4 PE=1 SV=1
19	P61969	5.09e-37	126	165	0.373	0.358	LMO4_MOUSE LIM domain transcription factor LMO4 OS=Mus musculus OX=10090 GN=Lmo4 PE=1 SV=1
20	Q9VL21	8.02e-29	107	241	0.335	0.220	Q9VL21_DROME LD11652p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5708 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	76	15.0	TFIIH C1-like domain
2	PF00412 LIM	7.7e-25	98.2	LIM domain
3	PF03347 TDH	5.1e+02	11.6	Vibrio thermostable direct hemolysin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 28737.XP_006883849.1

Rank	PPI partner	STRING score	Description
1	28737.XP_006879709.1	0.999	T-cell acute lymphocytic leukemia protein 1
2	28737.XP_006880052.1	0.996	LIM domain-binding protein 1 isoform X1
3	28737.XP_006902971.1	0.994	Erythroid transcription factor
4	28737.XP_006884579.1	0.988	LIM domain-binding protein 2 isoform X1
5	28737.XP_006895241.1	0.884	Endothelial transcription factor GATA-2 isoform X1
6	28737.XP_006897996.1	0.882	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins
7	28737.XP_006889923.1	0.873	Single-stranded DNA-binding protein 2 isoform X1
8	28737.XP_006885018.1	0.850	Transcriptional activator Myb isoform X1
9	28737.XP_006886795.1	0.805	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 5 Proteins
10	28737.XP_006891912.1	0.799	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 14 Proteins
11	28737.XP_006879776.1	0.784	Single-stranded DNA-binding protein 3 isoform X1
12	28737.XP_006900888.1	0.768	Protein lyl-1
13	28737.XP_006894569.1	0.762	Transcription factor 12-like isoform X1
14	28737.XP_006896747.1	0.751	Transcription factor PU.1 isoform X1
15	28737.XP_006884950.1	0.746	Transcription factor GATA-4
16	28737.XP_006891781.1	0.742	Transcription factor 4 isoform X1
17	28737.XP_006887796.1	0.722	LIM/homeobox protein Lhx4
18	28737.XP_006900636.1	0.722	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 15 Proteins
19	28737.XP_006896936.1	0.713	Transcription factor GATA-5
20	28737.XP_006901128.1	0.709	Transcription factor GATA-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.884	transcription regulator activity
GO:0003712	0.457	transcription coregulator activity
GO:0008134	0.414	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.954	developmental process
GO:0065007	0.926	biological regulation
GO:0050794	0.918	regulation of cellular process
GO:0009987	0.903	cellular process
GO:0048869	0.893	cellular developmental process
GO:0019222	0.880	regulation of metabolic process
GO:0032501	0.865	multicellular organismal process
GO:0060255	0.864	regulation of macromolecule metabolic process
GO:0048518	0.852	positive regulation of biological process
GO:0048856	0.839	anatomical structure development
GO:0048522	0.811	positive regulation of cellular process
GO:0010468	0.798	regulation of gene expression
GO:0031323	0.749	regulation of cellular metabolic process
GO:0006357	0.739	regulation of transcription by RNA polymerase II
GO:0045893	0.728	positive regulation of DNA-templated transcription
GO:0050896	0.719	response to stimulus
GO:0030154	0.707	cell differentiation
GO:0007275	0.685	multicellular organism development
GO:0045944	0.587	positive regulation of transcription by RNA polymerase II
GO:0042221	0.539	response to chemical
GO:0048513	0.456	animal organ development
GO:0010033	0.361	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.988	protein-containing complex
GO:0070013	0.863	intracellular organelle lumen
GO:0005667	0.831	transcription regulator complex
GO:0031981	0.828	nuclear lumen
GO:0005654	0.315	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]