StarFunc result for job id P25940

User Input

>input (1745 residues)
MGNRRDLGQPRAGLCLLLAALQLLPGTQADPVDVLKALGVQGGQAGVPEGPGFCPQRTPE
GDRAFRIGQASTLGIPTWELFPEGHFPENFSLLITLRGQPANQSVLLSIYDERGARQLGL
ALGPALGLLGDPFRPLPQQVNLTDGRWHRVAVSIDGEMVTLVADCEAQPPVLGHGPRFIS
IAGLTVLGTQDLGEKTFEGDIQELLISPDPQAAFQACERYLPDCDNLAPAATVAPQGEPE
TPRPRRKGKGKGRKKGRGRKGKGRKKNKEIWTSSPPPDSAENQTSTDIPKTETPAPNLPP
TPTPLVVTSTVTTGLNATILERSLDPDSGTELGTLETKAAREDEEGDDSTMGPDFRAAEY
PSRTQFQIFPGAGEKGAKGEPAVIEKGQQFEGPPGAPGPQGVVGPSGPPGPPGFPGDPGP
PGPAGLPGIPGIDGIRGPPGTVIMMPFQFAGGSFKGPPVSFQQAQAQAVLQQTQLSMKGP
PGPVGLTGRPGPVGLPGHPGLKGEEGAEGPQGPRGLQGPHGPPGRVGKMGRPGADGARGL
PGDTGPKGDRGFDGLPGLPGEKGQRGDFGHVGQPGPPGEDGERGAEGPPGPTGQAGEPGP
RGLLGPRGSPGPTGRPGVTGIDGAPGAKGNVGPPGEPGPPGQQGNHGSQGLPGPQGLIGT
PGEKGPPGNPGIPGLPGSDGPLGHPGHEGPTGEKGAQGPPGSAGPPGYPGPRGVKGTSGN
RGLQGEKGEKGEDGFPGFKGDVGLKGDQGKPGAPGPRGEDGPEGPKGQAGQAGEEGPPGS
AGEKGKLGVPGLPGYPGRPGPKGSIGFPGPLGPIGEKGKSGKTGQPGLEGERGPPGSRGE
RGQPGATGQPGPKGDVGQDGAPGIPGEKGLPGLQGPPGFPGPKGPPGHQGKDGRPGHPGQ
RGELGFQGQTGPPGPAGVLGPQGKTGEVGPLGERGPPGPPGPPGEQGLPGLEGREGAKGE
LGPPGPLGKEGPAGLRGFPGPKGGPGDPGPTGLKGDKGPPGPVGANGSPGERGPLGPAGG
IGLPGQSGSEGPVGPAGKKGSRGERGPPGPTGKDGIPGPLGPLGPPGAAGPSGEEGDKGD
VGAPGHKGSKGDKGDAGPPGQPGIRGPAGHPGPPGADGAQGRRGPPGLFGQKGDDGVRGF
VGVIGPPGLQGLPGPPGEKGEVGDVGSMGPHGAPGPRGPQGPTGSEGTPGLPGGVGQPGA
VGEKGERGDAGDPGPPGAPGIPGPKGDIGEKGDSGPSGAAGPPGKKGPPGEDGAKGSVGP
TGLPGDLGPPGDPGVSGIDGSPGEKGDPGDVGGPGPPGASGEPGAPGPPGKRGPSGHMGR
EGREGEKGAKGEPGPDGPPGRTGPMGARGPPGRVGPEGLRGIPGPVGEPGLLGAPGQMGP
PGPLGPSGLPGLKGDTGPKGEKGHIGLIGLIGPPGEAGEKGDQGLPGVQGPPGPKGDPGP
PGPIGSLGHPGPPGVAGPLGQKGSKGSPGSMGPRGDTGPAGPPGPPGAPAELHGLRRRRR
FVPVPLPVVEGGLEEVLASLTSLSLELEQLRRPPGTAERPGLVCHELHRNHPHLPDGEYW
IDPNQGCARDSFRVFCNFTAGGETCLYPDKKFEIVKLASWSKEKPGGWYSTFRRGKKFSY
VDADGSPVNVVQLNFLKLLSATARQNFTYSCQNAAAWLDEATGDYSHSARFLGTNGEELS
FNQTTAATVSVPQDGCRLRKGQTKTLFEFSSSRAGFLPLWDVAATDFGQTNQKFGFELGP
VCFSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P25940	1.000	1.000	0.000	1745	1.000	1.000	P25940.pdb.gz	CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens OX=9606 GN=COL5A3 PE=1 SV=3
2	AFDB:Q9JLI2	0.267	0.268	0.000	1739	0.823	0.826	Q9JLI2.pdb.gz	Q9JLI2_MOUSE Collagen type V alpha 3 chain OS=Mus musculus OX=10090 GN=Col5a3 PE=1 SV=1
3	AFDB:P12107	0.235	0.228	7.037E-104	1806	0.590	0.570	P12107.pdb.gz	COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens OX=9606 GN=COL11A1 PE=1 SV=4
4	AFDB:Q9JI03	0.163	0.155	2.399E-101	1840	0.594	0.563	Q9JI03.pdb.gz	CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus OX=10116 GN=Col5a1 PE=1 SV=1
5	AFDB:I3ISS1	0.253	0.245	2.547E-97	1803	0.551	0.534	I3ISS1.pdb.gz
6	AFDB:F6T0B3	0.210	0.221	2.785E-80	1650	0.538	0.569	F6T0B3.pdb.gz	F6T0B3_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=2
7	AFDB:Q8IZC6	0.117	0.111	1.156E-43	1860	0.371	0.348	Q8IZC6.pdb.gz	CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens OX=9606 GN=COL27A1 PE=1 SV=1
8	AFDB:A0MSJ1	0.125	0.130	2.836E-42	1658	0.358	0.376	A0MSJ1.pdb.gz	CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio OX=7955 GN=col27a1b PE=2 SV=1
9	AFDB:Q5QNQ9	0.118	0.112	8.552E-42	1845	0.375	0.354	Q5QNQ9.pdb.gz	CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus OX=10090 GN=Col27a1 PE=2 SV=1
10	AFDB:Q17RW2	0.114	0.116	2.068E-41	1714	0.358	0.364	Q17RW2.pdb.gz	COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens OX=9606 GN=COL24A1 PE=1 SV=2
11	PDB:3v0aB	0.077	0.115	1.268E-7	1150	0.014	0.022	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
12	PDB:7zl1A	0.069	0.483	2.496E-6	215	0.015	0.126	7zl1A.pdb.gz
13	PDB:2a3wA	0.068	0.509	2.032E-5	204	0.012	0.103	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.
14	PDB:3ffzA	0.079	0.107	2.829E-5	1246	0.013	0.018	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
15	PDB:4pbpB	0.070	0.511	2.829E-5	210	0.011	0.090	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
16	PDB:5n0cA	0.073	0.096	2.990E-5	1293	0.015	0.020	5n0cA.pdb.gz	The structure of the tetanus toxin reveals pH-mediated domain dynamics.
17	PDB:7ufgB	0.077	0.111	3.728E-5	1182	0.017	0.025	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
18	PDB:3vv1A	0.061	0.515	6.474E-5	141	0.010	0.128	3vv1A.pdb.gz	Structural basis of preferential binding of fucose-containing saccharide by the Caenorhabditis elegans galectin LEC-6
19	PDB:7ufgA	0.075	0.111	6.474E-5	1151	0.017	0.026	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
20	PDB:1b09A	0.071	0.527	9.014E-5	206	0.008	0.068	1b09A.pdb.gz	The physiological structure of human C-reactive protein and its complex with phosphocholine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K069	966	1736	0.545	0.548	A0A0G2K069_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=2
2	A0A8I5ZM36	964	1715	0.543	0.553	A0A8I5ZM36_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1
3	A0A8I5ZR92	960	1676	0.542	0.564	A0A8I5ZR92_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1
4	A0A8I5ZY93	973	1710	0.544	0.555	A0A8I5ZY93_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1
5	A0A8I6A1U6	839	1655	0.487	0.513	A0A8I6A1U6_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1
6	A0A8I6AUU9	958	1689	0.540	0.558	A0A8I6AUU9_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1
7	F1R5X4	1019	1721	0.556	0.564	F1R5X4_DANRE Collagen alpha-2(XI) chain isoform X6 OS=Danio rerio OX=7955 GN=col11a1 PE=1 SV=2
8	F6T0B3	838	1629	0.497	0.532	F6T0B3_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=2
9	F7EVZ0	1961	1736	0.821	0.825	F7EVZ0_RAT Collagen type V alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col5a3 PE=4 SV=1
10	P12107	1056	1806	0.589	0.569	COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens OX=9606 GN=COL11A1 PE=1 SV=4
11	P13942	812	1736	0.470	0.473	COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens OX=9606 GN=COL11A2 PE=1 SV=5
12	P20908	1005	1838	0.591	0.561	CO5A1_HUMAN Collagen alpha-1(V) chain OS=Homo sapiens OX=9606 GN=COL5A1 PE=1 SV=3
13	P20909	1072	1804	0.582	0.563	COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus OX=10116 GN=Col11a1 PE=1 SV=2
14	P25940	3214	1745	1.000	1.000	CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens OX=9606 GN=COL5A3 PE=1 SV=3
15	Q32S24	985	1736	0.548	0.551	COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus OX=9913 GN=COL11A2 PE=3 SV=1
16	Q61245	1102	1804	0.584	0.565	COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus OX=10090 GN=Col11a1 PE=1 SV=2
17	Q64739	988	1736	0.546	0.548	COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus OX=10090 GN=Col11a2 PE=2 SV=3
18	Q6MGB2	870	1617	0.519	0.560	Q6MGB2_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1
19	Q920S4	1087	1053	0.474	0.785	Q920S4_MOUSE Adipocyte-specific protein 6 OS=Mus musculus OX=10090 GN=Col5a3 PE=2 SV=1
20	Q9IAU4	1038	1835	0.595	0.566	Q9IAU4_CHICK Alpha 1 (V) collagen OS=Gallus gallus OX=9031 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01410 COLFI	4.2e-84	293.1	Fibrillar collagen C-terminal domain
2	PF01391 Collagen	5.4e-160	530.6	Collagen triple helix repeat (20 copies)
3	PF02210 Laminin_G_2	8.2	18.5	Laminin G domain
4	PF13385 Laminin_G_3	2.6e+02	13.1	Concanavalin A-like lectin/glucanases superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264828

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223061	0.937	Procollagen C-endopeptidase enhancer 1
2	9606.ENSP00000297268	0.937	Collagen alpha-2(I) chain
3	9606.ENSP00000251582	0.934	A disintegrin and metalloproteinase with thrombospondin motifs 2
4	9606.ENSP00000362304	0.929	A disintegrin and metalloproteinase with thrombospondin motifs 14
5	9606.ENSP00000295992	0.928	Procollagen C-endopeptidase enhancer 2
6	9606.ENSP00000266718	0.924	Lumican
7	9606.ENSP00000286657	0.923	A disintegrin and metalloproteinase with thrombospondin motifs 3
8	9606.ENSP00000401749	0.917	Prolyl 4-hydroxylase subunit alpha-3
9	9606.ENSP00000305714	0.915	Bone morphogenetic protein 1
10	9606.ENSP00000359114	0.911	Collagen alpha-1(XI) chain
11	9606.ENSP00000363840	0.910	Collagen alpha-2(XI) chain
12	9606.ENSP00000263556	0.907	Prolyl 4-hydroxylase subunit alpha-1
13	9606.ENSP00000384999	0.907	Prolyl 4-hydroxylase subunit alpha-2
14	9606.ENSP00000061240	0.904	Tolloid-like protein 1
15	9606.ENSP00000350630	0.901	Tolloid-like protein 2
16	9606.ENSP00000360882	0.801	Collagen alpha-1(V) chain
17	9606.ENSP00000304408	0.800	Collagen alpha-1(III) chain
18	9606.ENSP00000364000	0.800	Collagen alpha-2(V) chain
19	9606.ENSP00000225964	0.782	Collagen alpha-1(I) chain
20	9606.ENSP00000369889	0.755	Collagen alpha-1(II) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030020	1.000	extracellular matrix structural constituent conferring tensile strength
GO:1901681	0.999	sulfur compound binding
GO:0005539	0.999	glycosaminoglycan binding
GO:0008201	0.836	heparin binding
GO:0043394	0.717	proteoglycan binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0007155	0.982	cell adhesion
GO:0031589	0.972	cell-substrate adhesion
GO:0007160	0.935	cell-matrix adhesion
GO:0032502	0.806	developmental process
GO:0032501	0.779	multicellular organismal process
GO:0048856	0.526	anatomical structure development
GO:0007275	0.392	multicellular organism development
GO:0030198	0.351	extracellular matrix organization
GO:0050789	0.318	regulation of biological process
GO:0050794	0.303	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	1.000	collagen-containing extracellular matrix
GO:0012505	0.997	endomembrane system
GO:0070013	0.997	intracellular organelle lumen
GO:0032991	0.995	protein-containing complex
GO:0005737	0.993	cytoplasm
GO:0005581	0.992	collagen trimer
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0005576	0.990	extracellular region
GO:0099081	0.976	supramolecular polymer
GO:0098644	0.976	complex of collagen trimers
GO:0005788	0.938	endoplasmic reticulum lumen
GO:0098643	0.917	banded collagen fibril
GO:0005583	0.913	fibrillar collagen trimer

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]