StarFunc result for job id P25942

User Input

>input (277 residues)
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL
PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV
LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTN
KTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPD
DLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P25942	1.000	1.000	2.089E-50	277	1.000	1.000	P25942.pdb.gz	TNR5_HUMAN Tumor necrosis factor receptor superfamily member 5 OS=Homo sapiens OX=9606 GN=CD40 PE=1 SV=1
2	AFDB:Q4QQW2	0.609	0.584	3.534E-35	289	0.592	0.567	Q4QQW2.pdb.gz
3	AFDB:P27512	0.588	0.565	1.560E-34	289	0.614	0.588	P27512.pdb.gz	TNR5_MOUSE Tumor necrosis factor receptor superfamily member 5 OS=Mus musculus OX=10090 GN=Cd40 PE=1 SV=3
4	AFDB:F1M8Z6	0.545	0.250	3.640E-21	633	0.307	0.134	F1M8Z6.pdb.gz	F1M8Z6_RAT TNF receptor superfamily member 11A OS=Rattus norvegicus OX=10116 GN=Tnfrsf11a PE=4 SV=2
5	AFDB:Q9Y6Q6	0.541	0.255	2.397E-20	616	0.325	0.146	Q9Y6Q6.pdb.gz	TNR11_HUMAN Tumor necrosis factor receptor superfamily member 11A OS=Homo sapiens OX=9606 GN=TNFRSF11A PE=1 SV=1
6	AFDB:P36941	0.490	0.327	8.418E-20	435	0.289	0.184	P36941.pdb.gz	TNR3_HUMAN Tumor necrosis factor receptor superfamily member 3 OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=1
7	AFDB:Q71F55	0.492	0.494	2.793E-19	276	0.238	0.239	Q71F55.pdb.gz	Q71F55_MOUSE Herpes virus entry mediator OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
8	AFDB:P50284	0.480	0.343	4.410E-19	415	0.274	0.183	P50284.pdb.gz	TNR3_MOUSE Tumor necrosis factor receptor superfamily member 3 OS=Mus musculus OX=10090 GN=Ltbr PE=1 SV=1
9	AFDB:F1RAS9	0.426	0.296	1.282E-17	425	0.238	0.155	F1RAS9.pdb.gz	F1RAS9_DANRE Tumor necrosis factor receptor superfamily, member 1B OS=Danio rerio OX=7955 GN=tnfrsf1b PE=4 SV=2
10	AFDB:A5D8S6	0.432	0.211	5.343E-17	637	0.220	0.096	A5D8S6.pdb.gz	A5D8S6_DANRE Tnfrsf21 protein OS=Danio rerio OX=7955 GN=wu:fc29a09 PE=2 SV=1
11	PDB:7e9hR	0.187	0.083	1.696	766	0.065	0.023	7e9hR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
12	PDB:7epcA	0.193	0.085	1.696	782	0.090	0.032	7epcA.pdb.gz
13	PDB:8a7dQ	0.085	0.085	1.901	273	0.069	0.070	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
14	PDB:7wihA	0.152	0.065	2.389	741	0.058	0.022	7wihA.pdb.gz	Structural basis of the activation of metabotropic glutamate receptor 3.
15	PDB:4gouA	0.070	0.046	2.835	507	0.036	0.020	4gouA.pdb.gz
16	PDB:5cvnB	0.072	0.063	3.178	321	0.014	0.012	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
17	PDB:7x29B	0.076	0.025	3.365	1190	0.051	0.012	7x29B.pdb.gz
18	PDB:7x29A	0.085	0.033	3.772	991	0.051	0.014	7x29A.pdb.gz
19	PDB:6b2eB	0.063	0.083	4.228	193	0.051	0.073	6b2eB.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
20	PDB:3ihpB	0.068	0.036	4.740	681	0.011	0.004	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P25942	0.0	566	277	1.000	1.000	TNR5_HUMAN Tumor necrosis factor receptor superfamily member 5 OS=Homo sapiens OX=9606 GN=CD40 PE=1 SV=1
2	P27512	2.64e-124	357	289	0.621	0.595	TNR5_MOUSE Tumor necrosis factor receptor superfamily member 5 OS=Mus musculus OX=10090 GN=Cd40 PE=1 SV=3
3	A0A8I6AHI1	1.85e-113	331	309	0.599	0.537	A0A8I6AHI1_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
4	F6SVZ3	2.94e-107	313	269	0.556	0.572	F6SVZ3_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
5	A0A8I6A4J5	4.44e-98	290	260	0.545	0.581	A0A8I6A4J5_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
6	A0A8I5XVD8	1.93e-67	210	204	0.365	0.495	A0A8I5XVD8_RAT CD40 molecule OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
7	O35305	5.07e-38	143	625	0.300	0.133	TNR11_MOUSE Tumor necrosis factor receptor superfamily member 11A OS=Mus musculus OX=10090 GN=Tnfrsf11a PE=1 SV=1
8	Q9Y6Q6	1.23e-35	136	616	0.264	0.119	TNR11_HUMAN Tumor necrosis factor receptor superfamily member 11A OS=Homo sapiens OX=9606 GN=TNFRSF11A PE=1 SV=1
9	F1M8Z6	9.61e-35	134	633	0.256	0.112	F1M8Z6_RAT TNF receptor superfamily member 11A OS=Rattus norvegicus OX=10116 GN=Tnfrsf11a PE=4 SV=2
10	Q80WM9	1.07e-28	112	275	0.282	0.284	TNR14_MOUSE Tumor necrosis factor receptor superfamily member 14 OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
11	Q71F55	2.32e-28	111	276	0.274	0.275	Q71F55_MOUSE Herpes virus entry mediator OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
12	P20333	4.58e-23	100	461	0.235	0.141	TNR1B_HUMAN Tumor necrosis factor receptor superfamily member 1B OS=Homo sapiens OX=9606 GN=TNFRSF1B PE=1 SV=3
13	P36941	1.83e-21	95.1	435	0.253	0.161	TNR3_HUMAN Tumor necrosis factor receptor superfamily member 3 OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=1
14	Q92956	8.63e-20	88.6	283	0.209	0.205	TNR14_HUMAN Tumor necrosis factor receptor superfamily member 14 OS=Homo sapiens OX=9606 GN=TNFRSF14 PE=1 SV=3
15	O00300	1.13e-19	89.7	401	0.202	0.140	TR11B_HUMAN Tumor necrosis factor receptor superfamily member 11B OS=Homo sapiens OX=9606 GN=TNFRSF11B PE=1 SV=3
16	F1RAS9	1.20e-19	90.1	425	0.184	0.120	F1RAS9_DANRE Tumor necrosis factor receptor superfamily, member 1B OS=Danio rerio OX=7955 GN=tnfrsf1b PE=4 SV=2
17	F5H6F8	1.39e-19	86.7	217	0.249	0.318	F5H6F8_HUMAN Lymphotoxin beta receptor (Fragment) OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=8
18	O08727	2.57e-19	89.0	401	0.213	0.147	TR11B_RAT Tumor necrosis factor receptor superfamily member 11B OS=Rattus norvegicus OX=10116 GN=Tnfrsf11b PE=2 SV=1
19	O08712	7.27e-19	87.4	401	0.199	0.137	TR11B_MOUSE Tumor necrosis factor receptor superfamily member 11B OS=Mus musculus OX=10090 GN=Tnfrsf11b PE=1 SV=1
20	B8X730	7.81e-19	86.3	286	0.292	0.283	B8X730_DANRE CD40 molecule, TNF receptor superfamily member 5 OS=Danio rerio OX=7955 GN=si:ch211-231h20.3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09972 DUF2207	7e+02	10.3	Predicted membrane protein (DUF2207)
2	PF20087 DUF6479	2.6e+02	13.7	Family of unknown function (DUF6479)
3	PF01102 Glycophorin_A	6.1e+02	12.1	Glycophorin A
4	PF18278 RANK_CRD_2	34	16.0	Receptor activator of the NF-KB cysteine-rich repeat domain 2
5	PF00020 TNFR_c6	3.2e-12	58.0	TNFR/NGFR cysteine-rich region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361359

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247668	0.999	TNF receptor-associated factor 2
2	9606.ENSP00000359663	0.999	CD40 ligand
3	9606.ENSP00000362994	0.999	TNF receptor-associated factor 1
4	9606.ENSP00000433623	0.999	TNF receptor-associated factor 6
5	9606.ENSP00000454207	0.999	TNF receptor-associated factor 3
6	9606.ENSP00000261464	0.998	TNF receptor-associated factor 5
7	9606.ENSP00000384273	0.998	Transcription factor p65
8	9606.ENSP00000391676	0.997	Tyrosine-protein kinase JAK3
9	9606.ENSP00000477613	0.991	Baculoviral IAP repeat-containing protein 2
10	9606.ENSP00000295025	0.989	Proto-oncogene c-Rel
11	9606.ENSP00000011653	0.988	T-cell surface glycoprotein CD4
12	9606.ENSP00000221452	0.988	Transcription factor RelB
13	9606.ENSP00000367440	0.988	Tyrosyl-DNA phosphodiesterase 2
14	9606.ENSP00000302961	0.985	Heat shock protein family A member 4
15	9606.ENSP00000263464	0.983	Baculoviral IAP repeat-containing protein 3
16	9606.ENSP00000216797	0.976	NF-kappa-B inhibitor alpha
17	9606.ENSP00000382423	0.974	Mitogen-activated protein kinase kinase kinase 1
18	9606.ENSP00000415941	0.970	Complement C4-B
19	9606.ENSP00000231449	0.969	Interleukin-4
20	9606.ENSP00000378974	0.967	Mitogen-activated protein kinase 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044389	1.000	ubiquitin-like protein ligase binding
GO:0038023	0.999	signaling receptor activity
GO:0031625	0.992	ubiquitin protein ligase binding
GO:0004888	0.440	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0048518	0.989	positive regulation of biological process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0051716	0.985	cellular response to stimulus
GO:0009893	0.977	positive regulation of metabolic process
GO:0007154	0.976	cell communication
GO:0010604	0.974	positive regulation of macromolecule metabolic process
GO:0006952	0.966	defense response
GO:0048522	0.966	positive regulation of cellular process
GO:0023052	0.965	signaling
GO:0048583	0.952	regulation of response to stimulus
GO:0010468	0.931	regulation of gene expression
GO:0051239	0.914	regulation of multicellular organismal process
GO:0048584	0.914	positive regulation of response to stimulus
GO:0009605	0.912	response to external stimulus
GO:0007165	0.865	signal transduction
GO:0043085	0.863	positive regulation of catalytic activity
GO:0040012	0.853	regulation of locomotion
GO:0051171	0.850	regulation of nitrogen compound metabolic process
GO:0023051	0.843	regulation of signaling
GO:1902533	0.830	positive regulation of intracellular signal transduction
GO:0048519	0.828	negative regulation of biological process
GO:0001934	0.820	positive regulation of protein phosphorylation
GO:0042981	0.818	regulation of apoptotic process
GO:2000145	0.811	regulation of cell motility
GO:0010556	0.797	regulation of macromolecule biosynthetic process
GO:0051338	0.796	regulation of transferase activity
GO:0043408	0.791	regulation of MAPK cascade
GO:0002376	0.780	immune system process
GO:0030334	0.773	regulation of cell migration
GO:2001141	0.770	regulation of RNA biosynthetic process
GO:0051336	0.752	regulation of hydrolase activity
GO:0010628	0.733	positive regulation of gene expression
GO:2000026	0.730	regulation of multicellular organismal development
GO:0051240	0.723	positive regulation of multicellular organismal process
GO:0006355	0.717	regulation of DNA-templated transcription
GO:0043410	0.710	positive regulation of MAPK cascade
GO:0042127	0.708	regulation of cell population proliferation
GO:1901342	0.699	regulation of vasculature development
GO:0007166	0.697	cell surface receptor signaling pathway
GO:0032501	0.682	multicellular organismal process
GO:0045859	0.671	regulation of protein kinase activity
GO:0050730	0.666	regulation of peptidyl-tyrosine phosphorylation
GO:0050731	0.648	positive regulation of peptidyl-tyrosine phosphorylation
GO:0006955	0.616	immune response
GO:0051347	0.599	positive regulation of transferase activity
GO:0044419	0.578	biological process involved in interspecies interaction between organisms
GO:0002682	0.567	regulation of immune system process
GO:0048523	0.567	negative regulation of cellular process
GO:0051094	0.555	positive regulation of developmental process
GO:0009607	0.535	response to biotic stimulus
GO:0045765	0.522	regulation of angiogenesis
GO:0033674	0.509	positive regulation of kinase activity
GO:0002684	0.501	positive regulation of immune system process
GO:0042221	0.500	response to chemical
GO:0051707	0.495	response to other organism
GO:0080134	0.476	regulation of response to stress
GO:0045860	0.476	positive regulation of protein kinase activity
GO:0010033	0.458	response to organic substance
GO:0001817	0.452	regulation of cytokine production
GO:0070887	0.445	cellular response to chemical stimulus
GO:0051090	0.424	regulation of DNA-binding transcription factor activity
GO:1904035	0.408	regulation of epithelial cell apoptotic process
GO:0006954	0.362	inflammatory response
GO:0001775	0.358	cell activation
GO:0071900	0.350	regulation of protein serine/threonine kinase activity
GO:0034097	0.342	response to cytokine
GO:0051091	0.341	positive regulation of DNA-binding transcription factor activity
GO:0098542	0.339	defense response to other organism
GO:0010942	0.337	positive regulation of cell death
GO:0001819	0.326	positive regulation of cytokine production
GO:0071840	0.322	cellular component organization or biogenesis
GO:2000351	0.320	regulation of endothelial cell apoptotic process
GO:0040017	0.315	positive regulation of locomotion
GO:0043068	0.315	positive regulation of programmed cell death
GO:0071310	0.310	cellular response to organic substance
GO:0050776	0.306	regulation of immune response
GO:0043405	0.300	regulation of MAP kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.998	membrane-bounded organelle
GO:0005615	0.996	extracellular space
GO:0005622	0.976	intracellular anatomical structure
GO:0009986	0.958	cell surface
GO:0031982	0.952	vesicle
GO:0005737	0.949	cytoplasm
GO:1903561	0.916	extracellular vesicle
GO:0043231	0.910	intracellular membrane-bounded organelle
GO:0070062	0.712	extracellular exosome
GO:0043233	0.446	organelle lumen
GO:0005829	0.423	cytosol
GO:0005634	0.389	nucleus
GO:0031981	0.358	nuclear lumen
GO:0032991	0.353	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]