StarFunc result for job id P25963

User Input

>input (317 residues)
MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP
RGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE
DELPYDDCVFGGQRLTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P25963	1.000	1.000	6.343E-44	317	1.000	1.000	P25963.pdb.gz	IKBA_HUMAN NF-kappa-B inhibitor alpha OS=Homo sapiens OX=9606 GN=NFKBIA PE=1 SV=1
2	AFDB:G3V3I4	0.513	0.589	2.016E-29	274	0.864	1.000	G3V3I4.pdb.gz	G3V3I4_HUMAN NFKB inhibitor alpha OS=Homo sapiens OX=9606 GN=NFKBIA PE=1 SV=1
3	AFDB:Q6K196	0.705	0.716	9.984E-26	312	0.483	0.490	Q6K196.pdb.gz
4	AFDB:Q60778	0.642	0.569	4.878E-15	359	0.328	0.290	Q60778.pdb.gz	IKBB_MOUSE NF-kappa-B inhibitor beta OS=Mus musculus OX=10090 GN=Nfkbib PE=1 SV=2
5	AFDB:Q0II00	0.658	0.237	5.592E-15	902	0.278	0.098	Q0II00.pdb.gz	Q0II00_DANRE Nuclear factor NF-kappa-B p100 subunit OS=Danio rerio OX=7955 GN=p100 PE=1 SV=1
6	AFDB:A0A024RD24	0.611	0.392	1.389E-14	500	0.303	0.192	A0A024RD24.pdb.gz
7	AFDB:Q15653	0.616	0.549	3.611E-14	356	0.306	0.272	Q15653.pdb.gz	IKBB_HUMAN NF-kappa-B inhibitor beta OS=Homo sapiens OX=9606 GN=NFKBIB PE=1 SV=2
8	AFDB:Q20KN0	0.609	0.446	3.779E-14	439	0.309	0.223	Q20KN0.pdb.gz	Q20KN0_CARRO IkB OS=Carcinoscorpius rotundicauda OX=6848 PE=1 SV=1
9	AFDB:P25799	0.670	0.228	7.826E-14	971	0.297	0.097	P25799.pdb.gz	NFKB1_MOUSE Nuclear factor NF-kappa-B p105 subunit OS=Mus musculus OX=10090 GN=Nfkb1 PE=1 SV=2
10	AFDB:Q03017	0.645	0.416	8.571E-14	500	0.297	0.188	Q03017.pdb.gz	CACT_DROME NF-kappa-B inhibitor cactus OS=Drosophila melanogaster OX=7227 GN=cact PE=1 SV=2
11	PDB:8cs9A	0.553	0.230	6.137E-10	796	0.202	0.080	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:4oauC	0.492	0.243	1.202E-7	692	0.167	0.077	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
13	PDB:2dvwA	0.542	0.735	1.509E-7	229	0.167	0.231	2dvwA.pdb.gz
14	PDB:1wg0A	0.443	0.554	6.771E-7	243	0.167	0.218	1wg0A.pdb.gz
15	PDB:5vkqA	0.497	0.117	7.416E-7	1499	0.186	0.039	5vkqA.pdb.gz
16	PDB:6v9hC	0.526	0.610	1.402E-6	270	0.164	0.193	6v9hC.pdb.gz
17	PDB:6aunA	0.275	0.147	2.313E-6	618	0.183	0.094	6aunA.pdb.gz
18	PDB:6jd6B	0.457	0.732	2.313E-6	192	0.126	0.208	6jd6B.pdb.gz
19	PDB:6mwqA	0.445	0.291	2.533E-6	493	0.174	0.112	6mwqA.pdb.gz
20	PDB:1bu9A	0.439	0.781	8.267E-6	168	0.155	0.292	1bu9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V3I4	0.0	543	274	0.864	1.000	G3V3I4_HUMAN NFKB inhibitor alpha OS=Homo sapiens OX=9606 GN=NFKBIA PE=1 SV=1
2	P25963	0.0	653	317	1.000	1.000	IKBA_HUMAN NF-kappa-B inhibitor alpha OS=Homo sapiens OX=9606 GN=NFKBIA PE=1 SV=1
3	Q08353	0.0	606	314	0.943	0.952	IKBA_PIG NF-kappa-B inhibitor alpha OS=Sus scrofa OX=9823 GN=NFKBIA PE=1 SV=1
4	Q63746	0.0	588	314	0.909	0.917	IKBA_RAT NF-kappa-B inhibitor alpha OS=Rattus norvegicus OX=10116 GN=Nfkbia PE=2 SV=1
5	Q9Z1E3	0.0	590	314	0.912	0.920	IKBA_MOUSE NF-kappa-B inhibitor alpha OS=Mus musculus OX=10090 GN=Nfkbia PE=1 SV=2
6	F1QCG4	5.27e-89	270	310	0.448	0.458	F1QCG4_DANRE Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha a OS=Danio rerio OX=7955 GN=fj16a07 PE=4 SV=1
7	Q20KN0	6.25e-39	144	439	0.262	0.189	Q20KN0_CARRO IkB OS=Carcinoscorpius rotundicauda OX=6848 PE=1 SV=1
8	Q6P780	2.53e-37	138	365	0.290	0.252	Q6P780_RAT NFKB inhibitor epsilon OS=Rattus norvegicus OX=10116 GN=Nfkbie PE=4 SV=1
9	Q63369	9.13e-37	139	522	0.268	0.163	NFKB1_RAT Nuclear factor NF-kappa-B p105 subunit OS=Rattus norvegicus OX=10116 GN=Nfkb1 PE=1 SV=2
10	O54910	1.25e-36	136	364	0.287	0.250	IKBE_MOUSE NF-kappa-B inhibitor epsilon OS=Mus musculus OX=10090 GN=Nfkbie PE=1 SV=2
11	Q7LC14	3.95e-35	132	361	0.297	0.260	Q7LC14_HUMAN NFKB inhibitor epsilon OS=Homo sapiens OX=9606 GN=NFKBIE PE=1 SV=1
12	Q03017	4.24e-35	135	500	0.290	0.184	CACT_DROME NF-kappa-B inhibitor cactus OS=Drosophila melanogaster OX=7227 GN=cact PE=1 SV=2
13	P19838	5.34e-35	137	968	0.274	0.090	NFKB1_HUMAN Nuclear factor NF-kappa-B p105 subunit OS=Homo sapiens OX=9606 GN=NFKB1 PE=1 SV=2
14	A0A8I6ASQ1	7.25e-35	132	358	0.274	0.243	A0A8I6ASQ1_RAT NFKB inhibitor epsilon OS=Rattus norvegicus OX=10116 GN=Nfkbie PE=1 SV=1
15	O00221	5.95e-34	132	500	0.297	0.188	IKBE_HUMAN NF-kappa-B inhibitor epsilon OS=Homo sapiens OX=9606 GN=NFKBIE PE=1 SV=3
16	P25799	1.66e-33	132	971	0.265	0.087	NFKB1_MOUSE Nuclear factor NF-kappa-B p105 subunit OS=Mus musculus OX=10090 GN=Nfkb1 PE=1 SV=2
17	Q04861	1.12e-32	130	983	0.252	0.081	NFKB1_CHICK Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus OX=9031 GN=NFKB1 PE=2 SV=2
18	E7FFI8	9.94e-31	124	619	0.249	0.128	E7FFI8_DANRE B-cell lymphoma 3 protein homolog OS=Danio rerio OX=7955 GN=bcl3 PE=4 SV=1
19	Q60778	6.06e-30	118	359	0.287	0.253	IKBB_MOUSE NF-kappa-B inhibitor beta OS=Mus musculus OX=10090 GN=Nfkbib PE=1 SV=2
20	Q15653	1.07e-28	115	356	0.271	0.242	IKBB_HUMAN NF-kappa-B inhibitor beta OS=Homo sapiens OX=9606 GN=NFKBIB PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	2e-24	96.1	Ankyrin repeat
2	PF12796 Ank_2	6.9e-24	95.6	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	6.3e-20	80.0	Ankyrin repeat
4	PF13637 Ank_4	1.9e-16	71.4	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.6e-18	77.7	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216797

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000226574	0.999	Nuclear factor NF-kappa-B p105 subunit
2	9606.ENSP00000295025	0.999	Proto-oncogene c-Rel
3	9606.ENSP00000359206	0.999	F-box/WD repeat-containing protein 1A
4	9606.ENSP00000359424	0.999	Inhibitor of nuclear factor kappa-B kinase subunit alpha
5	9606.ENSP00000384273	0.999	Transcription factor p65
6	9606.ENSP00000403701	0.999	Beta-arrestin-2
7	9606.ENSP00000430684	0.999	Inhibitor of nuclear factor kappa-B kinase subunit beta
8	9606.ENSP00000483825	0.999	NF-kappa-B essential modulator
9	9606.ENSP00000221452	0.997	Transcription factor RelB
10	9606.ENSP00000231487	0.993	S-phase kinase-associated protein 1
11	9606.ENSP00000398698	0.992	Tumor necrosis factor
12	9606.ENSP00000362649	0.990	Histone deacetylase 1
13	9606.ENSP00000358983	0.985	Nuclear factor NF-kappa-B p100 subunit
14	9606.ENSP00000358997	0.985	Interleukin-1 receptor-associated kinase 1
15	9606.ENSP00000409581	0.985	Beta-arrestin-1
16	9606.ENSP00000433623	0.985	TNF receptor-associated factor 6
17	9606.ENSP00000312988	0.983	NF-kappa-B inhibitor beta
18	9606.ENSP00000348056	0.983	SUMO-conjugating enzyme UBC9
19	9606.ENSP00000263253	0.982	Histone acetyltransferase p300
20	9606.ENSP00000360266	0.981	Transcription factor AP-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0009987	0.998	cellular process
GO:0050794	0.998	regulation of cellular process
GO:0051716	0.994	cellular response to stimulus
GO:0048518	0.994	positive regulation of biological process
GO:0080090	0.994	regulation of primary metabolic process
GO:0051171	0.994	regulation of nitrogen compound metabolic process
GO:0031323	0.994	regulation of cellular metabolic process
GO:0048583	0.989	regulation of response to stimulus
GO:0023052	0.988	signaling
GO:0010468	0.986	regulation of gene expression
GO:0048519	0.985	negative regulation of biological process
GO:0010033	0.985	response to organic substance
GO:0080134	0.983	regulation of response to stress
GO:0008104	0.979	protein localization
GO:0007154	0.977	cell communication
GO:0006355	0.976	regulation of DNA-templated transcription
GO:0009893	0.967	positive regulation of metabolic process
GO:0007165	0.966	signal transduction
GO:0034097	0.961	response to cytokine
GO:0044092	0.955	negative regulation of molecular function
GO:0010604	0.955	positive regulation of macromolecule metabolic process
GO:0071345	0.948	cellular response to cytokine stimulus
GO:0043433	0.948	negative regulation of DNA-binding transcription factor activity
GO:0031347	0.946	regulation of defense response
GO:0031349	0.944	positive regulation of defense response
GO:0032088	0.943	negative regulation of NF-kappaB transcription factor activity
GO:0051235	0.942	maintenance of location
GO:0032103	0.934	positive regulation of response to external stimulus
GO:0048523	0.923	negative regulation of cellular process
GO:0007166	0.920	cell surface receptor signaling pathway
GO:0051173	0.893	positive regulation of nitrogen compound metabolic process
GO:0051093	0.880	negative regulation of developmental process
GO:0034612	0.867	response to tumor necrosis factor
GO:0045595	0.859	regulation of cell differentiation
GO:0071356	0.828	cellular response to tumor necrosis factor
GO:0002682	0.824	regulation of immune system process
GO:0002684	0.812	positive regulation of immune system process
GO:0051246	0.810	regulation of protein metabolic process
GO:0002376	0.798	immune system process
GO:0023051	0.795	regulation of signaling
GO:0010646	0.795	regulation of cell communication
GO:0009966	0.792	regulation of signal transduction
GO:0048522	0.791	positive regulation of cellular process
GO:0006954	0.781	inflammatory response
GO:0045596	0.756	negative regulation of cell differentiation
GO:0031325	0.743	positive regulation of cellular metabolic process
GO:0009891	0.740	positive regulation of biosynthetic process
GO:0009605	0.734	response to external stimulus
GO:0045185	0.727	maintenance of protein location
GO:0010557	0.725	positive regulation of macromolecule biosynthetic process
GO:1903508	0.708	positive regulation of nucleic acid-templated transcription
GO:0012501	0.702	programmed cell death
GO:0045893	0.701	positive regulation of DNA-templated transcription
GO:0051234	0.699	establishment of localization
GO:1901700	0.691	response to oxygen-containing compound
GO:0045944	0.689	positive regulation of transcription by RNA polymerase II
GO:0009607	0.688	response to biotic stimulus
GO:0044419	0.687	biological process involved in interspecies interaction between organisms
GO:0006810	0.674	transport
GO:0051239	0.669	regulation of multicellular organismal process
GO:0032502	0.664	developmental process
GO:0051707	0.659	response to other organism
GO:0019221	0.635	cytokine-mediated signaling pathway
GO:0032501	0.604	multicellular organismal process
GO:0048856	0.604	anatomical structure development
GO:0035556	0.589	intracellular signal transduction
GO:0051049	0.567	regulation of transport
GO:0033993	0.552	response to lipid
GO:1905952	0.523	regulation of lipid localization
GO:0014070	0.504	response to organic cyclic compound
GO:0051050	0.493	positive regulation of transport
GO:0007275	0.420	multicellular organism development
GO:0051247	0.420	positive regulation of protein metabolic process
GO:0048585	0.413	negative regulation of response to stimulus
GO:0032368	0.406	regulation of lipid transport
GO:0008152	0.401	metabolic process
GO:0009892	0.395	negative regulation of metabolic process
GO:1905954	0.360	positive regulation of lipid localization
GO:0071704	0.359	organic substance metabolic process
GO:0010883	0.353	regulation of lipid storage
GO:0032371	0.353	regulation of sterol transport
GO:0071702	0.349	organic substance transport
GO:0032370	0.336	positive regulation of lipid transport
GO:1905953	0.333	negative regulation of lipid localization
GO:0032374	0.333	regulation of cholesterol transport
GO:1902531	0.310	regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0032991	0.990	protein-containing complex
GO:0016020	0.962	membrane
GO:0071944	0.949	cell periphery
GO:0005654	0.946	nucleoplasm
GO:0005886	0.944	plasma membrane
GO:0140535	0.398	intracellular protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]