StarFunc result for job id P26006

User Input

>input (1051 residues)
MGPGPSRAPRAPRLMLCALALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHR
QTERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTY
HNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYK
DPEDQGNLYIGYTMQVGSFILHPKNITIVTGAPRHRHMGAVFLLSQEAGGDLRRRQVLEG
SQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVFMNQAGTSFPAHPSLL
LHGPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLLRQPQQVIHGE
KLGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVPRPAVL
DPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFH
GFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQA
QALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNT
RTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAF
EVIGVTLHTRDLQVQLQLSTSSHQDNLWPMILTLLVDYTLQTSLSMVNHRLQSFFGGTVM
GESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITVHG
NGSWPCRPPGDLINPLNLTLSDPGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSET
VLTCATGRAHCVWLECPIPDAPVVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRT
SIPTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFK
RARTRALYEAKRQKAEMKSQPSETERLTDDY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZQM3	0.700	0.690	0.000	1067	0.843	0.830	D3ZQM3.pdb.gz	D3ZQM3_RAT Integrin subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Itga3 PE=3 SV=2
2	AFDB:D7PS99	0.698	0.703	0.000	1041	0.468	0.473	D7PS99.pdb.gz	D7PS99_DANRE Integrin alpha 3 protein OS=Danio rerio OX=7955 GN=im:7155971 PE=1 SV=1
3	AFDB:P26006	1.000	1.000	0.000	1051	1.000	1.000	P26006.pdb.gz	ITA3_HUMAN Integrin alpha-3 OS=Homo sapiens OX=9606 GN=ITGA3 PE=1 SV=5
4	AFDB:Q62470	0.686	0.684	0.000	1053	0.876	0.875	Q62470.pdb.gz	ITA3_MOUSE Integrin alpha-3 OS=Mus musculus OX=10090 GN=Itga3 PE=1 SV=1
5	AFDB:P26007	0.565	0.555	2.961E-101	1072	0.369	0.362	P26007.pdb.gz	ITA6_CHICK Integrin alpha-6 OS=Gallus gallus OX=9031 GN=ITGA6 PE=2 SV=1
6	AFDB:A8WHQ8	0.715	0.691	7.725E-101	1092	0.365	0.352	A8WHQ8.pdb.gz	A8WHQ8_DANRE Integrin alpha-6 isoform X1 OS=Danio rerio OX=7955 GN=itga6a PE=1 SV=1
7	AFDB:P23229	0.586	0.548	2.230E-100	1130	0.377	0.350	P23229.pdb.gz	ITA6_HUMAN Integrin alpha-6 OS=Homo sapiens OX=9606 GN=ITGA6 PE=1 SV=5
8	AFDB:Q13683	0.562	0.505	1.121E-99	1181	0.380	0.338	Q13683.pdb.gz	ITA7_HUMAN Integrin alpha-7 OS=Homo sapiens OX=9606 GN=ITGA7 PE=1 SV=3
9	AFDB:Q61739	0.566	0.547	4.165E-99	1091	0.364	0.351	Q61739.pdb.gz	ITA6_MOUSE Integrin alpha-6 OS=Mus musculus OX=10090 GN=Itga6 PE=1 SV=3
10	AFDB:Q63258	0.709	0.663	4.380E-99	1135	0.376	0.348	Q63258.pdb.gz	ITA7_RAT Integrin alpha-7 OS=Rattus norvegicus OX=10116 GN=Itga7 PE=1 SV=2
11	PDB:4g1eA	0.491	0.532	1.504E-67	964	0.233	0.254	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
12	PDB:3fcsA	0.483	0.551	6.032E-63	913	0.229	0.264	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
13	PDB:7nxdA	0.487	0.561	3.033E-62	905	0.235	0.273	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
14	PDB:7uslA	0.467	0.566	2.496E-59	856	0.206	0.252	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
15	PDB:3k6sC	0.479	0.561	1.744E-54	885	0.187	0.223	3k6sC.pdb.gz	Structure of an integrin with an alphaI domain, complement receptor type 4.
16	PDB:4nenA	0.450	0.445	2.245E-54	1063	0.193	0.191	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
17	PDB:4nehA	0.472	0.458	5.568E-54	1084	0.205	0.198	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
18	PDB:4rtdA	0.088	0.085	7.194E-9	1122	0.055	0.052	4rtdA.pdb.gz
19	PDB:4ziqA	0.110	0.089	1.133E-8	1450	0.085	0.061	4ziqA.pdb.gz
20	PDB:5a42A	0.089	0.069	1.318E-8	1597	0.081	0.053	5a42A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A5C8	586	1073	0.353	0.346	A0A8I6A5C8_RAT Integrin subunit alpha 6 OS=Rattus norvegicus OX=10116 GN=Itga6 PE=1 SV=1
2	A0A8I6AJE9	611	1129	0.382	0.355	A0A8I6AJE9_RAT Integrin subunit alpha 6 OS=Rattus norvegicus OX=10116 GN=Itga6 PE=1 SV=1
3	A0A8I6G9S4	637	1061	0.385	0.382	A0A8I6G9S4_RAT Integrin subunit alpha 6 OS=Rattus norvegicus OX=10116 GN=Itga6 PE=1 SV=1
4	A0A8I6GLI8	1801	1050	0.858	0.859	A0A8I6GLI8_RAT Integrin subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Itga3 PE=3 SV=1
5	A8WHQ7	616	1071	0.383	0.376	A8WHQ7_DANRE Integrin alpha-6 isoform X2 OS=Danio rerio OX=7955 GN=itga6a PE=1 SV=1
6	A8WHQ8	604	1092	0.379	0.364	A8WHQ8_DANRE Integrin alpha-6 isoform X1 OS=Danio rerio OX=7955 GN=itga6a PE=1 SV=1
7	D3ZCG9	1853	1052	0.873	0.873	D3ZCG9_RAT Integrin alpha 3 variant A OS=Rattus norvegicus OX=10116 GN=Itga3 PE=2 SV=1
8	D3ZQM3	1736	1055	0.811	0.808	D3ZQM3_RAT Integrin subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Itga3 PE=3 SV=2
9	D7PS99	956	1041	0.474	0.478	D7PS99_DANRE Integrin alpha 3 protein OS=Danio rerio OX=7955 GN=im:7155971 PE=1 SV=1
10	F1R2R3	957	1041	0.475	0.479	F1R2R3_DANRE Integrin alpha-3 isoform X1 OS=Danio rerio OX=7955 GN=im:7145180 PE=1 SV=1
11	G3V667	639	1073	0.389	0.381	G3V667_RAT Integrin subunit alpha 6 OS=Rattus norvegicus OX=10116 GN=Itga6 PE=1 SV=1
12	I4DUB5	1790	1067	0.850	0.837	I4DUB5_RAT Integrin alpha 3 variant B OS=Rattus norvegicus OX=10116 GN=Itga3 PE=2 SV=1
13	P23229	641	1130	0.392	0.365	ITA6_HUMAN Integrin alpha-6 OS=Homo sapiens OX=9606 GN=ITGA6 PE=1 SV=5
14	P26006	2178	1051	1.000	1.000	ITA3_HUMAN Integrin alpha-3 OS=Homo sapiens OX=9606 GN=ITGA3 PE=1 SV=5
15	P26007	644	1072	0.378	0.370	ITA6_CHICK Integrin alpha-6 OS=Gallus gallus OX=9031 GN=ITGA6 PE=2 SV=1
16	Q13683	585	1181	0.389	0.346	ITA7_HUMAN Integrin alpha-7 OS=Homo sapiens OX=9606 GN=ITGA7 PE=1 SV=3
17	Q61738	561	1179	0.377	0.336	ITA7_MOUSE Integrin alpha-7 OS=Mus musculus OX=10090 GN=Itga7 PE=1 SV=3
18	Q61739	623	1091	0.383	0.369	ITA6_MOUSE Integrin alpha-6 OS=Mus musculus OX=10090 GN=Itga6 PE=1 SV=3
19	Q62470	1855	1053	0.878	0.877	ITA3_MOUSE Integrin alpha-3 OS=Mus musculus OX=10090 GN=Itga3 PE=1 SV=1
20	Q63258	602	1135	0.389	0.360	ITA7_RAT Integrin alpha-7 OS=Rattus norvegicus OX=10116 GN=Itga7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01839 FG-GAP	1.9e-22	90.0	FG-GAP repeat
2	PF14312 FG-GAP_2	0.06	24.9	FG-GAP repeat
3	PF13517 FG-GAP_3	5.4e-09	47.8	FG-GAP-like repeat
4	PF08441 Integrin_alpha2	4e-94	327.9	Integrin alpha
5	PF14991 MLANA	4.5e+02	12.5	Protein melan-A
6	PF16185 MTABC_N	94	13.9	Mitochondrial ABC-transporter N-terminal five TM region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000010024

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000002560	0.991	Integrins alpha-1/beta-1, alpha-2/beta-1, alpha-10/beta-1 and alpha-11/beta-1 are receptors for collagen. Integrins alpha-1/beta-1 and alpha-2/beta-2 recognize the proline-hydroxylated sequence G-F-P-G- E-R in collagen. Integrins alpha-2/beta-1, alpha-3/beta-1, alpha- 4/beta-1, alpha-5/beta-1, alpha-8/beta-1, alpha-10/beta-1, alpha- 11/beta-1 and alpha-V/beta-1 are receptors for fibronectin. Alpha- 4/beta-1 recognizes one or more domains within the alternatively spliced CS-1 and CS-5 regions of fibronectin. Integrin alpha-5/beta-1 is a receptor for fibrinogen. Integrin alpha-1/beta-1, [...]
2	9601.ENSPPYP00000010043	0.974	Belongs to the integrin beta chain family.
3	9601.ENSPPYP00000014692	0.972	Fibronectin 1
4	9601.ENSPPYP00000009696	0.969	Integrin, beta 4
5	9601.ENSPPYP00000003360	0.953	Tetraspanin
6	9601.ENSPPYP00000021213	0.953	Belongs to the protein kinase superfamily. Tyr protein kinase family
7	9601.ENSPPYP00000015061	0.947	Belongs to the integrin beta chain family.
8	9601.ENSPPYP00000014370	0.946	Pongo abelii integrin, beta 6 (ITGB6), mRNA
9	9601.ENSPPYP00000007178	0.945	Thrombospondin 1
10	9601.ENSPPYP00000024242	0.938	annotation not available
11	9601.ENSPPYP00000019894	0.937	Belongs to the integrin beta chain family.
12	9601.ENSPPYP00000005214	0.936	Belongs to the integrin beta chain family.
13	9601.ENSPPYP00000014440	0.914	Belongs to the integrin alpha chain family.
14	9601.ENSPPYP00000019356	0.914	Uncharacterized protein
15	9601.ENSPPYP00000012518	0.902	Laminin, alpha 5
16	9601.ENSPPYP00000023671	0.900	Laminin, gamma 1 (formerly LAMB2)
17	9601.ENSPPYP00000004764	0.898	Tetraspanin
18	9601.ENSPPYP00000000267	0.896	Laminin, beta 3
19	9601.ENSPPYP00000020074	0.895	Laminin, beta 1
20	9601.ENSPPYP00000010120	0.889	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050840	1.000	extracellular matrix binding
GO:0005178	0.999	integrin binding
GO:0005518	0.996	collagen binding
GO:0043236	0.992	laminin binding
GO:0019904	0.987	protein domain specific binding
GO:0001968	0.884	fibronectin binding
GO:0046982	0.825	protein heterodimerization activity
GO:0019899	0.548	enzyme binding
GO:0002020	0.423	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0048856	0.970	anatomical structure development
GO:0050896	0.969	response to stimulus
GO:0048518	0.960	positive regulation of biological process
GO:0032501	0.956	multicellular organismal process
GO:0007155	0.946	cell adhesion
GO:0048519	0.942	negative regulation of biological process
GO:0010810	0.929	regulation of cell-substrate adhesion
GO:0048522	0.924	positive regulation of cellular process
GO:0031346	0.911	positive regulation of cell projection organization
GO:0045785	0.906	positive regulation of cell adhesion
GO:0007275	0.901	multicellular organism development
GO:0010634	0.875	positive regulation of epithelial cell migration
GO:0048731	0.819	system development
GO:0060135	0.759	maternal process involved in female pregnancy
GO:0042221	0.744	response to chemical
GO:0048513	0.717	animal organ development
GO:0034698	0.711	response to gonadotropin
GO:0048523	0.704	negative regulation of cellular process
GO:0019222	0.672	regulation of metabolic process
GO:0060255	0.652	regulation of macromolecule metabolic process
GO:0120035	0.635	regulation of plasma membrane bounded cell projection organization
GO:0010975	0.530	regulation of neuron projection development
GO:0010976	0.462	positive regulation of neuron projection development
GO:0051716	0.450	cellular response to stimulus
GO:0007154	0.449	cell communication
GO:0071840	0.423	cellular component organization or biogenesis
GO:0007165	0.417	signal transduction
GO:0009653	0.413	anatomical structure morphogenesis
GO:0016043	0.392	cellular component organization
GO:0048583	0.379	regulation of response to stimulus
GO:0030154	0.348	cell differentiation
GO:0009888	0.306	tissue development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	0.999	cell junction
GO:0005886	0.999	plasma membrane
GO:0009986	0.997	cell surface
GO:0098796	0.996	membrane protein complex
GO:0005622	0.995	intracellular anatomical structure
GO:0098636	0.992	protein complex involved in cell adhesion
GO:0005737	0.987	cytoplasm
GO:0098590	0.985	plasma membrane region
GO:0098802	0.985	plasma membrane signaling receptor complex
GO:0008305	0.984	integrin complex
GO:0120025	0.982	plasma membrane bounded cell projection
GO:0030175	0.947	filopodium
GO:0045202	0.933	synapse
GO:0043226	0.923	organelle
GO:0097060	0.894	synaptic membrane
GO:0043227	0.858	membrane-bounded organelle
GO:0005576	0.839	extracellular region
GO:0043231	0.814	intracellular membrane-bounded organelle
GO:0031982	0.730	vesicle
GO:0005615	0.698	extracellular space
GO:0030055	0.532	cell-substrate junction
GO:0065010	0.518	extracellular membrane-bounded organelle
GO:0070062	0.500	extracellular exosome
GO:0048471	0.496	perinuclear region of cytoplasm
GO:0043005	0.466	neuron projection
GO:0098978	0.448	glutamatergic synapse
GO:0005925	0.438	focal adhesion
GO:0012505	0.310	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]