StarFunc result for job id P26022

User Input

>input (381 residues)
MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACGQEHSEWDKLF
IMLENSQMRERMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDEL
LQATRDAGRRLARMEGAEAQRPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCE
TAILFPMRSKKIFGSVHPVRPMRLESFSACIWVKATDVLNKTILFSYGTKRNPYEIQLYL
SYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGLTSLWVNGELAATTVEMATGH
IVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIR
GNIVGWGVTEIQPHGGAQYVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P26022	1.000	1.000	2.250E-72	381	1.000	1.000	P26022.pdb.gz	PTX3_HUMAN Pentraxin-related protein PTX3 OS=Homo sapiens OX=9606 GN=PTX3 PE=1 SV=3
2	AFDB:P48759	0.645	0.645	4.040E-56	381	0.819	0.819	P48759.pdb.gz	PTX3_MOUSE Pentraxin-related protein PTX3 OS=Mus musculus OX=10090 GN=Ptx3 PE=1 SV=2
3	AFDB:Q5UMH8	0.618	0.549	1.028E-43	433	0.572	0.503	Q5UMH8.pdb.gz	Q5UMH8_CHICK PPTX OS=Gallus gallus OX=9031 PE=1 SV=1
4	PDB:7zl1A	0.551	0.969	1.737E-39	215	0.564	1.000	7zl1A.pdb.gz
5	AFDB:F1Q689	0.469	0.422	4.251E-20	426	0.255	0.228	F1Q689.pdb.gz
6	AFDB:E7F742	0.483	0.345	7.788E-20	538	0.178	0.126	E7F742.pdb.gz
7	AFDB:O95502	0.475	0.366	1.683E-19	500	0.234	0.178	O95502.pdb.gz	NPTXR_HUMAN Neuronal pentraxin receptor OS=Homo sapiens OX=9606 GN=NPTXR PE=3 SV=2
8	AFDB:Q6DG61	0.478	0.406	4.532E-19	451	0.260	0.220	Q6DG61.pdb.gz
9	AFDB:P97738	0.478	0.424	1.363E-18	432	0.236	0.208	P97738.pdb.gz	NPTX2_RAT Neuronal pentraxin-2 OS=Rattus norvegicus OX=10116 GN=Nptx2 PE=1 SV=1
10	AFDB:Q6TKP2	0.472	0.274	2.787E-18	672	0.192	0.109	Q6TKP2.pdb.gz	Q6TKP2_MOUSE Neuronal pentraxin with chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=2 SV=1
11	AFDB:P47971	0.476	0.422	3.287E-18	432	0.223	0.197	P47971.pdb.gz	NPTX1_RAT Neuronal pentraxin-1 OS=Rattus norvegicus OX=10116 GN=Nptx1 PE=1 SV=1
12	PDB:2a3wA	0.471	0.860	4.581E-17	204	0.123	0.230	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.
13	PDB:4pbpB	0.493	0.872	6.374E-17	210	0.123	0.224	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
14	PDB:1b09A	0.476	0.857	8.949E-16	206	0.139	0.257	1b09A.pdb.gz	The physiological structure of human C-reactive protein and its complex with phosphocholine.
15	PDB:8a7eC	0.407	0.110	1.255E-8	1524	0.084	0.021	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
16	PDB:7ufgB	0.407	0.140	2.300E-8	1182	0.081	0.026	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
17	PDB:7ufgA	0.368	0.132	1.017E-7	1151	0.079	0.026	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
18	PDB:3v0aB	0.323	0.115	5.299E-7	1150	0.081	0.027	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
19	PDB:3ffzA	0.286	0.094	1.278E-6	1246	0.081	0.025	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
20	PDB:7qfqA	0.227	0.078	3.443E-6	1291	0.087	0.026	7qfqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P26022	0.0	784	381	1.000	1.000	PTX3_HUMAN Pentraxin-related protein PTX3 OS=Homo sapiens OX=9606 GN=PTX3 PE=1 SV=3
2	P48759	0.0	649	381	0.819	0.819	PTX3_MOUSE Pentraxin-related protein PTX3 OS=Mus musculus OX=10090 GN=Ptx3 PE=1 SV=2
3	Q5UMH8	2.24e-147	426	433	0.577	0.508	Q5UMH8_CHICK PPTX OS=Gallus gallus OX=9031 PE=1 SV=1
4	D2D0C0	3.25e-28	116	426	0.247	0.221	D2D0C0_DANRE Neuronal pentraxin 2b OS=Danio rerio OX=7955 GN=nptx2b PE=2 SV=1
5	E9QB97	3.28e-25	108	530	0.194	0.140	E9QB97_DANRE Carbonic anhydrase OS=Danio rerio OX=7955 GN=ca6 PE=1 SV=1
6	P47972	4.31e-24	105	431	0.234	0.206	NPTX2_HUMAN Neuronal pentraxin-2 OS=Homo sapiens OX=9606 GN=NPTX2 PE=1 SV=2
7	O70340	7.07e-24	104	429	0.165	0.147	NPTX2_MOUSE Neuronal pentraxin-2 OS=Mus musculus OX=10090 GN=Nptx2 PE=2 SV=1
8	P97738	7.48e-24	104	432	0.165	0.146	NPTX2_RAT Neuronal pentraxin-2 OS=Rattus norvegicus OX=10116 GN=Nptx2 PE=1 SV=1
9	Q62443	9.61e-24	103	432	0.205	0.181	NPTX1_MOUSE Neuronal pentraxin-1 OS=Mus musculus OX=10090 GN=Nptx1 PE=1 SV=1
10	P47971	9.90e-24	103	432	0.205	0.181	NPTX1_RAT Neuronal pentraxin-1 OS=Rattus norvegicus OX=10116 GN=Nptx1 PE=1 SV=1
11	Q15818	1.07e-23	103	432	0.202	0.178	NPTX1_HUMAN Neuronal pentraxin-1 OS=Homo sapiens OX=9606 GN=NPTX1 PE=1 SV=2
12	D2D0C1	7.05e-23	101	433	0.184	0.162	D2D0C1_DANRE Neuronal pentraxin 2a OS=Danio rerio OX=7955 GN=nptx2 PE=2 SV=1
13	A8E4K4	2.19e-22	100	432	0.181	0.160	A8E4K4_DANRE Neuronal pentraxin 2a precursor OS=Danio rerio OX=7955 GN=nptx2 PE=2 SV=1
14	O35764	6.91e-21	96.3	494	0.247	0.190	NPTXR_RAT Neuronal pentraxin receptor OS=Rattus norvegicus OX=10116 GN=Nptxr PE=1 SV=1
15	O95502	1.65e-19	92.0	500	0.249	0.190	NPTXR_HUMAN Neuronal pentraxin receptor OS=Homo sapiens OX=9606 GN=NPTXR PE=3 SV=2
16	H3BLN6	3.54e-19	90.1	372	0.241	0.247	H3BLN6_MOUSE Neuronal pentraxin chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=4 SV=1
17	Q2TS39	4.92e-19	86.7	210	0.144	0.262	Q2TS39_CARRO Pentraxin family member (Fragment) OS=Carcinoscorpius rotundicauda OX=6848 GN=CRP-1 PE=1 SV=1
18	F8VQB8	1.97e-18	89.0	469	0.213	0.173	F8VQB8_MOUSE Neuronal pentraxin chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=4 SV=1
19	P48199	3.34e-18	85.1	230	0.157	0.261	CRP_RAT C-reactive protein OS=Rattus norvegicus OX=10116 GN=Crp PE=1 SV=1
20	Q99J85	3.68e-18	88.2	493	0.239	0.185	NPTXR_MOUSE Neuronal pentraxin receptor OS=Mus musculus OX=10090 GN=Nptxr PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13385 Laminin_G_3	6.5e-16	70.2	Concanavalin A-like lectin/glucanases superfamily
2	PF00354 Pentaxin	3.7e-26	103.5	Pentaxin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295927

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264498	0.997	Fibroblast growth factor 2
2	9606.ENSP00000360871	0.997	Ficolin-1
3	9606.ENSP00000356399	0.995	Complement factor H
4	9606.ENSP00000291744	0.993	Ficolin-2
5	9606.ENSP00000243347	0.988	Tumor necrosis factor-inducible gene 6 protein
6	9606.ENSP00000263686	0.988	P-selectin
7	9606.ENSP00000363079	0.977	Mannose-binding protein C
8	9606.ENSP00000363773	0.975	Complement C1q subcomponent subunit A
9	9606.ENSP00000314299	0.908	Complement factor H-related protein 1
10	9606.ENSP00000245907	0.799	Complement C3
11	9606.ENSP00000266041	0.760	Inter-alpha-trypsin inhibitor heavy chain H4
12	9606.ENSP00000271450	0.694	Low affinity immunoglobulin gamma Fc region receptor II-a
13	9606.ENSP00000363770	0.688	Complement C1q subcomponent subunit C
14	9606.ENSP00000385675	0.671	Interleukin-6
15	9606.ENSP00000308938	0.664	Plasminogen
16	9606.ENSP00000306991	0.660	Hyaluronan synthase 2
17	9606.ENSP00000225275	0.637	Myeloperoxidase
18	9606.ENSP00000270879	0.610	Ficolin-3
19	9606.ENSP00000385035	0.606	Complement C1s subcomponent
20	9606.ENSP00000478570	0.591	Vascular endothelial growth factor A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.953	identical protein binding
GO:0001846	0.824	opsonin binding
GO:0001848	0.823	complement binding
GO:0046790	0.814	virion binding
GO:0044877	0.795	protein-containing complex binding
GO:0030246	0.322	carbohydrate binding
GO:0036094	0.301	small molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050794	0.993	regulation of cellular process
GO:0050896	0.992	response to stimulus
GO:0051707	0.969	response to other organism
GO:0048519	0.962	negative regulation of biological process
GO:0006952	0.946	defense response
GO:0002376	0.932	immune system process
GO:0006955	0.921	immune response
GO:0009987	0.920	cellular process
GO:0019222	0.915	regulation of metabolic process
GO:0051246	0.895	regulation of protein metabolic process
GO:0031323	0.890	regulation of cellular metabolic process
GO:0065009	0.888	regulation of molecular function
GO:0048518	0.880	positive regulation of biological process
GO:0098542	0.862	defense response to other organism
GO:0050792	0.781	regulation of viral process
GO:0048522	0.771	positive regulation of cellular process
GO:0050790	0.767	regulation of catalytic activity
GO:1903900	0.733	regulation of viral life cycle
GO:0048523	0.712	negative regulation of cellular process
GO:0043903	0.700	regulation of biological process involved in symbiotic interaction
GO:0051702	0.658	biological process involved in interaction with symbiont
GO:0032501	0.541	multicellular organismal process
GO:0006954	0.534	inflammatory response
GO:0048525	0.530	negative regulation of viral process
GO:0044092	0.528	negative regulation of molecular function
GO:0052372	0.502	modulation by symbiont of entry into host
GO:1903901	0.501	negative regulation of viral life cycle
GO:0009892	0.491	negative regulation of metabolic process
GO:0045087	0.482	innate immune response
GO:0051336	0.476	regulation of hydrolase activity
GO:0032502	0.456	developmental process
GO:0046596	0.453	regulation of viral entry into host cell
GO:0032879	0.441	regulation of localization
GO:1903018	0.409	regulation of glycoprotein metabolic process
GO:0048856	0.402	anatomical structure development
GO:0051346	0.399	negative regulation of hydrolase activity
GO:0051049	0.395	regulation of transport
GO:0010468	0.383	regulation of gene expression
GO:0009893	0.380	positive regulation of metabolic process
GO:0051239	0.377	regulation of multicellular organismal process
GO:0048583	0.350	regulation of response to stimulus
GO:0008152	0.331	metabolic process
GO:0051851	0.318	modulation by host of symbiont process
GO:0007275	0.316	multicellular organism development
GO:0010605	0.310	negative regulation of macromolecule metabolic process
GO:0051050	0.303	positive regulation of transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0012505	0.994	endomembrane system
GO:0070013	0.993	intracellular organelle lumen
GO:0071944	0.985	cell periphery
GO:0043227	0.977	membrane-bounded organelle
GO:0043231	0.956	intracellular membrane-bounded organelle
GO:0005737	0.954	cytoplasm
GO:0031982	0.949	vesicle
GO:0030141	0.911	secretory granule
GO:0031012	0.700	extracellular matrix
GO:0065010	0.654	extracellular membrane-bounded organelle
GO:0031983	0.627	vesicle lumen
GO:0042581	0.626	specific granule
GO:0034774	0.624	secretory granule lumen
GO:0070062	0.621	extracellular exosome
GO:0070820	0.457	tertiary granule
GO:0016020	0.388	membrane
GO:1904724	0.383	tertiary granule lumen
GO:0035580	0.346	specific granule lumen
GO:0031981	0.338	nuclear lumen
GO:0005654	0.304	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]