StarFunc result for job id P26232

User Input

>input (953 residues)
MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVL
AASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKR
GTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFG
KEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANR
DYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFR
PSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGD
PLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQV
FREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQD
NMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTA
GAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANV
PQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDD
QLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCM
IMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQ
RIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVDCDVIDGGRASQLSTHL
PTCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVN
SPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFKAMDSF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P26232	1.000	1.000	0.000	953	1.000	1.000	P26232.pdb.gz	CTNA2_HUMAN Catenin alpha-2 OS=Homo sapiens OX=9606 GN=CTNNA2 PE=1 SV=5
2	AFDB:Q5U302	0.719	0.751	3.242E-84	908	0.776	0.815	Q5U302.pdb.gz	Q5U302_RAT Catenin alpha 1 OS=Rattus norvegicus OX=10116 GN=Ctnna1 PE=1 SV=1
3	AFDB:P35220	0.685	0.710	2.268E-68	917	0.600	0.624	P35220.pdb.gz	CTNA_DROME Catenin alpha OS=Drosophila melanogaster OX=7227 GN=alpha-Cat PE=1 SV=2
4	AFDB:Q65CL1	0.669	0.710	2.750E-67	895	0.567	0.603	Q65CL1.pdb.gz	CTNA3_MOUSE Catenin alpha-3 OS=Mus musculus OX=10090 GN=Ctnna3 PE=1 SV=2
5	PDB:4iggB	0.535	0.654	2.575E-63	771	0.655	0.809	4iggB.pdb.gz
6	AFDB:A5JYX3	0.608	0.623	2.005E-50	930	0.376	0.385	A5JYX3.pdb.gz	A5JYX3_CAEEL Vinculin OS=Caenorhabditis elegans OX=6239 GN=hmp-1 PE=1 SV=1
7	PDB:4k1nA	0.494	0.872	3.805E-39	520	0.434	0.796	4k1nA.pdb.gz
8	AFDB:A0A3B6UES5	0.569	0.635	1.117E-24	846	0.210	0.236	A0A3B6UES5.pdb.gz	VINC_OSCPE Vinculin OS=Oscarella pearsei OX=1940113 GN=VIN1 PE=1 SV=1
9	AFDB:H2L011	0.412	0.475	1.896E-24	812	0.238	0.280	H2L011.pdb.gz	H2L011_CAEEL Alpha-catulin OS=Caenorhabditis elegans OX=6239 GN=ctn-1 PE=1 SV=2
10	AFDB:F6NHA0	0.505	0.456	2.379E-24	1066	0.228	0.204	F6NHA0.pdb.gz	F6NHA0_DANRE Vinculin OS=Danio rerio OX=7955 GN=hm:zehn2160 PE=1 SV=1
11	AFDB:A0A024QZN4	0.495	0.446	2.664E-24	1066	0.233	0.208	A0A024QZN4.pdb.gz
12	AFDB:A0A0S2I7K2	0.494	0.445	3.889E-24	1066	0.225	0.201	A0A0S2I7K2.pdb.gz	A0A0S2I7K2_DANRE Vinculin OS=Danio rerio OX=7955 GN=vinculin-b PE=1 SV=1
13	PDB:6bfiB	0.553	0.646	7.673E-23	806	0.200	0.237	6bfiB.pdb.gz
14	PDB:6fuyA	0.506	0.502	1.763E-22	961	0.217	0.215	6fuyA.pdb.gz
15	PDB:6nr7A	0.507	0.451	2.882E-22	1086	0.234	0.205	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
16	PDB:1tr2B	0.500	0.466	1.464E-21	1029	0.212	0.196	1tr2B.pdb.gz
17	PDB:7ktuA	0.476	0.458	1.497E-15	995	0.222	0.213	7ktuA.pdb.gz
18	PDB:6r9tA	0.120	0.059	7.344E-4	2185	0.106	0.046	6r9tA.pdb.gz
19	PDB:6xz4A	0.115	0.333	2.480E-1	304	0.048	0.151	6xz4A.pdb.gz
20	PDB:7qpgW	0.075	0.086	2.885E-1	779	0.101	0.123	7qpgW.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384MDY0	0.0	1499	906	0.778	0.818	A0A384MDY0_HUMAN Catenin (Cadherin-associated protein), alpha 1, 102kDa, isoform CRA_b OS=Homo sapiens OX=9606 GN=CTNNA1 PE=2 SV=1
2	A5JYX3	0.0	635	930	0.377	0.386	A5JYX3_CAEEL Vinculin OS=Caenorhabditis elegans OX=6239 GN=hmp-1 PE=1 SV=1
3	G3XAM7	0.0	1362	841	0.699	0.792	G3XAM7_HUMAN Catenin (Cadherin-associated protein), alpha 1, 102kDa, isoform CRA_a OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1
4	P26231	0.0	1497	906	0.775	0.816	CTNA1_MOUSE Catenin alpha-1 OS=Mus musculus OX=10090 GN=Ctnna1 PE=1 SV=1
5	P26232	0.0	1962	953	1.000	1.000	CTNA2_HUMAN Catenin alpha-2 OS=Homo sapiens OX=9606 GN=CTNNA2 PE=1 SV=5
6	P30997	0.0	1818	906	0.943	0.992	CTNA2_CHICK Catenin alpha-2 OS=Gallus gallus OX=9031 GN=CTNNA2 PE=1 SV=1
7	P35220	0.0	1117	917	0.608	0.631	CTNA_DROME Catenin alpha OS=Drosophila melanogaster OX=7227 GN=alpha-Cat PE=1 SV=2
8	P35221	0.0	1499	906	0.778	0.818	CTNA1_HUMAN Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1
9	P90947	0.0	635	927	0.377	0.387	HMP1_CAEEL Alpha-catenin-like protein hmp-1 OS=Caenorhabditis elegans OX=6239 GN=hmp-1 PE=1 SV=2
10	Q5U302	0.0	1489	908	0.774	0.813	Q5U302_RAT Catenin alpha 1 OS=Rattus norvegicus OX=10116 GN=Ctnna1 PE=1 SV=1
11	Q61301	0.0	1961	953	0.999	0.999	CTNA2_MOUSE Catenin alpha-2 OS=Mus musculus OX=10090 GN=Ctnna2 PE=1 SV=3
12	Q65CL1	0.0	1068	895	0.572	0.609	CTNA3_MOUSE Catenin alpha-3 OS=Mus musculus OX=10090 GN=Ctnna3 PE=1 SV=2
13	Q9PVF8	0.0	1500	907	0.784	0.824	Q9PVF8_DANRE Catenin (Cadherin-associated protein), alpha OS=Danio rerio OX=7955 GN=ctnna PE=1 SV=1
14	Q9UI47	0.0	1071	895	0.576	0.613	CTNA3_HUMAN Catenin alpha-3 OS=Homo sapiens OX=9606 GN=CTNNA3 PE=1 SV=2
15	E5RIB1	6.61e-99	311	215	0.165	0.730	E5RIB1_HUMAN Catenin alpha 1 (Fragment) OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1
16	E5RJ41	1.37e-65	219	161	0.113	0.671	E5RJ41_HUMAN Catenin alpha 1 (Fragment) OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1
17	Q8T3U1	7.47e-53	198	642	0.169	0.251	Q8T3U1_CAEEL Alpha-catulin OS=Caenorhabditis elegans OX=6239 GN=ctn-1 PE=1 SV=2
18	G8JYB2	4.72e-52	198	784	0.169	0.205	G8JYB2_CAEEL Alpha-catulin OS=Caenorhabditis elegans OX=6239 GN=ctn-1 PE=1 SV=1
19	H2L011	5.88e-52	198	812	0.169	0.198	H2L011_CAEEL Alpha-catulin OS=Caenorhabditis elegans OX=6239 GN=ctn-1 PE=1 SV=2
20	Q9UBT7	2.09e-44	174	734	0.158	0.206	CTNL1_HUMAN Alpha-catulin OS=Homo sapiens OX=9606 GN=CTNNAL1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01044 Vinculin	0	1038.9	Vinculin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 27679.XP_003922592.1

Rank	PPI partner	STRING score	Description
1	27679.XP_010339764.1	0.997	Catenin beta-1 isoform X1
2	27679.XP_010345147.1	0.974	Cadherins are calcium-dependent cell adhesion proteins.
3	27679.XP_003940595.1	0.954	Belongs to the MAGUK family.
4	27679.XP_010333112.1	0.945	Catenin delta-1 isoform X1
5	27679.XP_003942730.1	0.944	Armadillo repeat protein deleted in velo-cardio-facial syndrome isoform X1
6	27679.XP_010341348.1	0.941	Catenin delta-2 isoform X1
7	27679.XP_010328289.1	0.940	Plakophilin-4 isoform X1
8	27679.XP_003924518.1	0.937	Alpha-actinin-1 isoform X1
9	27679.XP_010346330.1	0.935	Alpha-actinin-4 isoform X1
10	27679.XP_003939842.1	0.932	Vinculin isoform X2
11	27679.XP_003933979.1	0.925	Catenin alpha-1 isoform X1
12	27679.XP_010343671.1	0.911	Actin, cytoplasmic 1
13	27679.XP_010328928.1	0.894	Junction plakoglobin
14	27679.XP_010333922.1	0.891	Cadherins are calcium-dependent cell adhesion proteins.
15	27679.XP_010330774.1	0.871	Adenomatous polyposis coli protein 2
16	27679.XP_010347701.1	0.870	Cadherin-17
17	27679.XP_003936384.1	0.861	Cadherins are calcium-dependent cell adhesion proteins.
18	27679.XP_003920746.1	0.857	Adenomatous polyposis coli protein isoform X1
19	27679.XP_003934217.1	0.855	Thyroid receptor-interacting protein 6
20	27679.XP_010336016.1	0.855	Lipoma-preferred partner

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	0.999	protein-containing complex binding
GO:0008092	0.997	cytoskeletal protein binding
GO:0045296	0.996	cadherin binding
GO:0003779	0.991	actin binding
GO:0051015	0.960	actin filament binding
GO:0042802	0.720	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0032501	0.982	multicellular organismal process
GO:0065007	0.979	biological regulation
GO:0048856	0.978	anatomical structure development
GO:0007275	0.962	multicellular organism development
GO:0050789	0.946	regulation of biological process
GO:0050794	0.944	regulation of cellular process
GO:0048731	0.868	system development
GO:0048519	0.818	negative regulation of biological process
GO:0007399	0.805	nervous system development
GO:0071840	0.774	cellular component organization or biogenesis
GO:0016043	0.763	cellular component organization
GO:0030154	0.760	cell differentiation
GO:0050896	0.730	response to stimulus
GO:0040012	0.702	regulation of locomotion
GO:0048513	0.671	animal organ development
GO:0051128	0.646	regulation of cellular component organization
GO:0048523	0.611	negative regulation of cellular process
GO:0032970	0.605	regulation of actin filament-based process
GO:0009653	0.603	anatomical structure morphogenesis
GO:0000902	0.588	cell morphogenesis
GO:0048468	0.578	cell development
GO:0007155	0.508	cell adhesion
GO:0022008	0.501	neurogenesis
GO:2000145	0.390	regulation of cell motility
GO:1902903	0.375	regulation of supramolecular fiber organization
GO:0051716	0.315	cellular response to stimulus
GO:0030334	0.315	regulation of cell migration
GO:0007154	0.314	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.998	plasma membrane
GO:0030054	0.987	cell junction
GO:0005829	0.984	cytosol
GO:0070161	0.950	anchoring junction
GO:0043226	0.841	organelle
GO:0005911	0.714	cell-cell junction
GO:0043229	0.712	intracellular organelle
GO:0043227	0.689	membrane-bounded organelle
GO:0043231	0.605	intracellular membrane-bounded organelle
GO:0005912	0.560	adherens junction
GO:0042995	0.559	cell projection
GO:0120025	0.533	plasma membrane bounded cell projection
GO:0032991	0.356	protein-containing complex
GO:0070013	0.319	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]