StarFunc result for job id P26358

User Input

>input (1616 residues)
MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQ
LCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENGNQARSEARRV
GMADANSPPKPLSKPRTPRRSKSDGEAKPEPSPSPRITRKSTRQTTITSHFAKGPAKRKP
QEESERAKSDESIKEEDKDQDEKRRRVTSRERVARPLPAEEPERAKSGTRTEKEEERDEK
EEKRLRSQTKEPTPKQKLKEEPDREARAGVQADEDEDGDEKDEKKHRSQPKDLAAKRRPE
EKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTEKKMARAKTVMNSKTHPPKCIQCGQYL
DDPDLKYGQHPPDAVDEPQMLTNEKLSIFDANESGFESYEALPQHKLTCFSVYCKHGHLC
PIDTGLIEKNIELFFSGSAKPIYDDDPSLEGGVNGKNLGPINEWWITGFDGGEKALIGFS
TSFAEYILMDPSPEYAPIFGLMQEKIYISKIVVEFLQSNSDSTYEDLINKIETTVPPSGL
NLNRFTEDSLLRHAQFVVEQVESYDEAGDSDEQPIFLTPCMRDLIKLAGVTLGQRRAQAR
RQTIRHSTREKDRGPTKATTTKLVYQIFDTFFAEQIEKDDREDKENAFKRRRCGVCEVCQ
QPECGKCKACKDMVKFGGSGRSKQACQERRCPNMAMKEADDDEEVDDNIPEMPSPKKMHQ
GKKKKQNKNRISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVT
ALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPS
ENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLA
EMRQKEIPRVLEQLEDLDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPR
KEPVDEDLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIFCPKKSNGRPNETDIKIRVNK
FYRPENTHKSTPASYHADINLLYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYSMGGP
NRFYFLEAYNAKSKSFEDPPNHARSPGNKGKGKGKGKGKPKSQACEPSEPEIEIKLPKLR
TLDVFSGCGGLSEGFHQAGISDTLWAIEMWDPAAQAFRLNNPGSTVFTEDCNILLKLVMA
GETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRP
RFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAP
GEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNG
ASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLP
NIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCL
PHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFP
DTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13864	0.810	0.808	0.000	1620	0.775	0.773	P13864.pdb.gz	DNMT1_MOUSE DNA (cytosine-5)-methyltransferase 1 OS=Mus musculus OX=10090 GN=Dnmt1 PE=1 SV=5
2	AFDB:P26358	1.000	1.000	0.000	1616	1.000	1.000	P26358.pdb.gz	DNMT1_HUMAN DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1 PE=1 SV=2
3	AFDB:Q9Z330	0.777	0.774	0.000	1622	0.769	0.766	Q9Z330.pdb.gz	DNMT1_RAT DNA (cytosine-5)-methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Dnmt1 PE=1 SV=2
4	PDB:6fdfA	0.141	0.620	3.702E-9	325	0.045	0.222	6fdfA.pdb.gz	Structural insights into the stimulation of S. pombe Dnmt2 catalytic efficiency by the tRNA nucleoside queuosine.
5	PDB:5z8lA	0.068	0.466	9.113E-8	204	0.020	0.157	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
6	PDB:7r78A	0.155	0.136	1.694E-7	1880	0.051	0.044	7r78A.pdb.gz	Structural insights into DNMT5-mediated ATP-dependent high-fidelity epigenome maintenance.
7	PDB:7r76A	0.145	0.129	3.492E-7	1834	0.049	0.043	7r76A.pdb.gz	Structural insights into DNMT5-mediated ATP-dependent high-fidelity epigenome maintenance.
8	PDB:7t02A	0.145	0.135	3.059E-6	1752	0.046	0.043	7t02A.pdb.gz	Structural insights into DNMT5-mediated ATP-dependent high-fidelity epigenome maintenance.
9	AFDB:Q3LHL9	0.082	0.080	5.126E-6	1658	0.074	0.072	Q3LHL9.pdb.gz	WGE_DROME Protein winged eye OS=Drosophila melanogaster OX=7227 GN=wge PE=1 SV=1
10	PDB:7aoaD	0.052	0.228	5.988E-6	343	0.020	0.093	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
11	PDB:2bh2A	0.076	0.263	7.930E-5	418	0.017	0.065	2bh2A.pdb.gz	A Unique RNA Fold in the Ruma-RNA-Cofactor Ternary Complex Contributes to Substrate Selectivity and Enzymatic Function
12	PDB:3bt7A	0.075	0.281	2.471E-4	369	0.015	0.068	3bt7A.pdb.gz	Structure of a TrmA-RNA complex: A consensus RNA fold contributes to substrate selectivity and catalysis in m5U methyltransferases.
13	PDB:5wp5A	0.077	0.230	3.200E-4	463	0.014	0.050	5wp5A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
14	PDB:4kdcA	0.074	0.454	1.672E-3	217	0.013	0.097	4kdcA.pdb.gz
15	AFDB:H0YL70	0.034	0.054	1.660E-1	782	0.045	0.093	H0YL70.pdb.gz	H0YL70_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
16	AFDB:O74653	0.041	0.055	2.150E-1	871	0.051	0.095	O74653.pdb.gz	POB1_SCHPO Protein pob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pob1 PE=1 SV=1
17	AFDB:F1N9Y3	0.026	0.044	2.643E-1	773	0.037	0.076	F1N9Y3.pdb.gz
18	AFDB:Q9LUS2	0.043	0.051	3.422E-1	1089	0.061	0.090	Q9LUS2.pdb.gz	TC120_ARATH Translocase of chloroplast 120, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC120 PE=1 SV=1
19	AFDB:Q07141	0.030	0.054	3.604E-1	748	0.043	0.092	Q07141.pdb.gz	TLE4_RAT Transducin-like enhancer protein 4 OS=Rattus norvegicus OX=10116 GN=Tle4 PE=1 SV=2
20	AFDB:O95819	0.031	0.032	6.362E-1	1239	0.055	0.072	O95819.pdb.gz	M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1RCN0	0.0	1983	1500	0.614	0.661	F1RCN0_DANRE DNA (cytosine-5)-methyltransferase OS=Danio rerio OX=7955 GN=cb1075 PE=1 SV=1
2	P13864	0.0	2464	1620	0.774	0.772	DNMT1_MOUSE DNA (cytosine-5)-methyltransferase 1 OS=Mus musculus OX=10090 GN=Dnmt1 PE=1 SV=5
3	P26358	0.0	3362	1616	1.000	1.000	DNMT1_HUMAN DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1 PE=1 SV=2
4	Q9Z330	0.0	2419	1622	0.767	0.764	DNMT1_RAT DNA (cytosine-5)-methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Dnmt1 PE=1 SV=2
5	P34881	6.05e-164	540	1534	0.212	0.224	DNMT1_ARATH DNA (cytosine-5)-methyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=DMT1 PE=1 SV=1
6	B1Q3J6	7.84e-164	539	1529	0.207	0.219	DNM1B_ORYSJ DNA (cytosine-5)-methyltransferase 1B OS=Oryza sativa subsp. japonica OX=39947 GN=MET1B PE=2 SV=1
7	Q7Y1I7	1.71e-163	538	1527	0.210	0.222	DNM1A_ORYSJ DNA (cytosine-5)-methyltransferase 1A OS=Oryza sativa subsp. japonica OX=39947 GN=MET1A PE=2 SV=1
8	O23273	2.10e-149	499	1519	0.196	0.208	DNMT4_ARATH DNA (cytosine-5)-methyltransferase 4 OS=Arabidopsis thaliana OX=3702 GN=MET4 PE=1 SV=1
9	Q9T0I1	2.03e-138	466	1404	0.186	0.214	DNMT3_ARATH DNA (cytosine-5)-methyltransferase 3 OS=Arabidopsis thaliana OX=3702 GN=MET3 PE=3 SV=1
10	Q94F88	1.05e-50	197	839	0.080	0.154	CMT3_ARATH DNA (cytosine-5)-methyltransferase CMT3 OS=Arabidopsis thaliana OX=3702 GN=CMT3 PE=1 SV=2
11	C0SQ89	4.18e-49	192	907	0.085	0.151	CMT3_ORYSJ DNA (cytosine-5)-methyltransferase CMT3 OS=Oryza sativa subsp. japonica OX=39947 GN=CMT3 PE=2 SV=1
12	O49139	8.05e-44	175	791	0.076	0.155	CMT1_ARATH Putative DNA (cytosine-5)-methyltransferase CMT1 OS=Arabidopsis thaliana OX=3702 GN=CMT1 PE=5 SV=2
13	Q94F87	9.34e-43	174	1295	0.075	0.094	CMT2_ARATH DNA (cytosine-5)-methyltransferase CMT2 OS=Arabidopsis thaliana OX=3702 GN=CMT2 PE=2 SV=3
14	G2WSP8	5.89e-35	149	1411	0.090	0.103	G2WSP8_VERDV Modification methylase AgeI OS=Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) OX=498257 GN=VDAG_00829 PE=3 SV=1
15	Q3Y3Z1	3.07e-24	114	1454	0.039	0.043	Q3Y3Z1_NEUCR DNA methyltransferase Dim-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=dim-2 PE=1 SV=1
16	Q72B90	3.43e-16	84.7	369	0.043	0.187	Q72B90_DESVH Cytosine-specific methyltransferase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_1746 PE=1 SV=1
17	A0A1B9GEF8	4.43e-12	73.6	920	0.050	0.087	A0A1B9GEF8_9TREE BAH domain-containing protein OS=Kwoniella bestiolae CBS 10118 OX=1296100 GN=I302_00877 PE=3 SV=1
18	A0A1B9I5J6	4.00e-11	70.5	766	0.050	0.104	A0A1B9I5J6_9TREE DNA (cytosine-5-)-methyltransferase OS=Kwoniella pini CBS 10737 OX=1296096 GN=I206_02856 PE=3 SV=1
19	A0A1B9ILM8	5.19e-11	70.1	921	0.031	0.054	A0A1B9ILM8_9TREE BAH domain-containing protein OS=Kwoniella mangroviensis CBS 10435 OX=1331196 GN=L486_05334 PE=3 SV=1
20	Q9YDP3	5.33e-10	66.2	469	0.037	0.128	MT872_AERPE DNA (cytosine-5-)-methyltransferase M.ApeKI OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) OX=272557 GN=APE_0872.1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01426 BAH	4.8e-44	160.5	BAH domain
2	PF06464 DMAP_binding	3e-17	74.8	DMAP1-binding Domain
3	PF00145 DNA_methylase	1.1e-43	161.5	C-5 cytosine-specific DNA methylase
4	PF12047 DNMT1-RFD	1.9e-44	162.6	Cytosine specific DNA methyltransferase replication foci domain
5	PF08461 HTH_12	3.3e+02	12.6	Ribonuclease R winged-helix domain
6	PF02008 zf-CXXC	1.9e-11	55.1	CXXC zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352516

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267163	0.999	Retinoblastoma-associated protein
2	9606.ENSP00000320147	0.999	Histone-lysine N-methyltransferase EZH2
3	9606.ENSP00000343535	0.999	Ubiquitin carboxyl-terminal hydrolase 7
4	9606.ENSP00000362649	0.999	Histone deacetylase 1
5	9606.ENSP00000430432	0.999	Histone deacetylase 2
6	9606.ENSP00000479617	0.999	E3 ubiquitin-protein ligase UHRF1
7	9606.ENSP00000264709	0.998	DNA (cytosine-5)-methyltransferase 3A
8	9606.ENSP00000328547	0.998	DNA (cytosine-5)-methyltransferase 3B
9	9606.ENSP00000364678	0.995	Histone-lysine N-methyltransferase EHMT2
10	9606.ENSP00000276893	0.994	E3 ubiquitin-protein ligase UHRF2
11	9606.ENSP00000363668	0.994	Death domain-associated protein 6
12	9606.ENSP00000269305	0.993	Cellular tumor antigen p53
13	9606.ENSP00000361363	0.993	DNA methyltransferase 1-associated protein 1
14	9606.ENSP00000395535	0.993	Methyl-CpG-binding protein 2
15	9606.ENSP00000244050	0.992	Zinc finger protein SNAI1
16	9606.ENSP00000264657	0.992	Signal transducer and activator of transcription 3
17	9606.ENSP00000337976	0.992	Histone-lysine N-methyltransferase SUV39H1
18	9606.ENSP00000368458	0.986	Proliferating cell nuclear antigen
19	9606.ENSP00000262904	0.981	Transcription factor E2F3
20	9606.ENSP00000212015	0.978	NAD-dependent protein deacetylase sirtuin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901363	0.995	heterocyclic compound binding
GO:0097159	0.995	organic cyclic compound binding
GO:0003886	0.995	DNA (cytosine-5-)-methyltransferase activity
GO:0005515	0.994	protein binding
GO:0003682	0.994	chromatin binding
GO:0003677	0.994	DNA binding
GO:0043565	0.915	sequence-specific DNA binding
GO:1990841	0.834	promoter-specific chromatin binding
GO:0051718	0.698	DNA (cytosine-5-)-methyltransferase activity, acting on CpG substrates
GO:0008270	0.366	zinc ion binding
GO:0019899	0.353	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0050789	0.995	regulation of biological process
GO:0044237	0.994	cellular metabolic process
GO:0050794	0.991	regulation of cellular process
GO:0044238	0.989	primary metabolic process
GO:0010468	0.989	regulation of gene expression
GO:0048519	0.988	negative regulation of biological process
GO:0006807	0.987	nitrogen compound metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0043412	0.984	macromolecule modification
GO:0006259	0.978	DNA metabolic process
GO:0019219	0.977	regulation of nucleobase-containing compound metabolic process
GO:0010629	0.977	negative regulation of gene expression
GO:0006306	0.970	DNA methylation
GO:0048523	0.911	negative regulation of cellular process
GO:0006325	0.890	chromatin organization
GO:1903506	0.855	regulation of nucleic acid-templated transcription
GO:0040029	0.841	epigenetic regulation of gene expression
GO:0048518	0.785	positive regulation of biological process
GO:0045814	0.781	negative regulation of gene expression, epigenetic
GO:0048522	0.737	positive regulation of cellular process
GO:0051172	0.720	negative regulation of nitrogen compound metabolic process
GO:0051128	0.719	regulation of cellular component organization
GO:0006355	0.714	regulation of DNA-templated transcription
GO:1903507	0.690	negative regulation of nucleic acid-templated transcription
GO:0006357	0.648	regulation of transcription by RNA polymerase II
GO:0050896	0.618	response to stimulus
GO:0045892	0.599	negative regulation of DNA-templated transcription
GO:0032502	0.565	developmental process
GO:0048856	0.557	anatomical structure development
GO:0032501	0.550	multicellular organismal process
GO:1902275	0.542	regulation of chromatin organization
GO:0051052	0.493	regulation of DNA metabolic process
GO:0000122	0.474	negative regulation of transcription by RNA polymerase II
GO:0009893	0.473	positive regulation of metabolic process
GO:0010604	0.430	positive regulation of macromolecule metabolic process
GO:0048731	0.388	system development
GO:1901564	0.370	organonitrogen compound metabolic process
GO:0051716	0.366	cellular response to stimulus
GO:0032776	0.304	DNA methylation on cytosine

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.951	protein-containing complex
GO:0005737	0.713	cytoplasm
GO:0043232	0.541	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13681	0.995	a 2'-deoxycytidine in DNA + S-adenosyl-L-methionine = a 5-methyl-2'-deoxycytidine in DNA + H(+) + S-adenosyl-L-homocysteine
EC:2.1.1.37	0.995	DNA (cytosine-5-)-methyltransferase.

[back to server]