StarFunc result for job id P26368

User Input

>input (475 residues)
MSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRR
RSKPLTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATA
LLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQ
APGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSE
NPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSK
GYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVSPPSTINQTPVTLQV
PGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRP
VDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P26368	1.000	1.000	1.190E-96	475	1.000	1.000	P26368.pdb.gz	U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2 PE=1 SV=4
2	AFDB:Q24562	0.672	0.762	1.984E-64	416	0.606	0.692	Q24562.pdb.gz	U2AF2_DROME Splicing factor U2AF 50 kDa subunit OS=Drosophila melanogaster OX=7227 GN=U2af50 PE=1 SV=1
3	AFDB:P90978	0.219	0.209	2.697E-53	496	0.556	0.532	P90978.pdb.gz	U2AF2_CAEEL Splicing factor U2AF 65 kDa subunit OS=Caenorhabditis elegans OX=6239 GN=uaf-1 PE=2 SV=2
4	AFDB:Q8T8Y4	0.259	0.270	6.911E-51	449	0.461	0.488	Q8T8Y4.pdb.gz	Q8T8Y4_DROME Splicing factor U2AF subunit OS=Drosophila melanogaster OX=7227 GN=LS2 PE=2 SV=1
5	AFDB:Q8L716	0.368	0.302	5.394E-40	589	0.415	0.334	Q8L716.pdb.gz	U2A2B_ARATH Splicing factor U2af large subunit B OS=Arabidopsis thaliana OX=3702 GN=U2AF65B PE=1 SV=2
6	AFDB:F4JQG2	0.309	0.271	1.924E-38	551	0.368	0.318	F4JQG2.pdb.gz	F4JQG2_ARATH Splicing factor U2af large subunit OS=Arabidopsis thaliana OX=3702 GN=ATU2AF65A PE=1 SV=1
7	AFDB:O23212	0.353	0.299	4.848E-38	573	0.381	0.316	O23212.pdb.gz	U2A2A_ARATH Splicing factor U2af large subunit A OS=Arabidopsis thaliana OX=3702 GN=U2AF65A PE=1 SV=2
8	AFDB:P36629	0.219	0.202	3.982E-32	517	0.305	0.280	P36629.pdb.gz	U2AF2_SCHPO Splicing factor U2AF 59 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp2 PE=1 SV=1
9	AFDB:Q9VM49	0.195	0.160	3.057E-23	594	0.229	0.184	Q9VM49.pdb.gz	Q9VM49_DROME Caper, isoform A OS=Drosophila melanogaster OX=7227 GN=Caper PE=1 SV=1
10	AFDB:A0A384NQ03	0.189	0.170	1.717E-22	530	0.217	0.194	A0A384NQ03.pdb.gz	A0A384NQ03_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
11	PDB:5vsuA	0.162	0.194	4.998E-14	387	0.097	0.119	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
12	PDB:7evoD	0.164	0.378	1.783E-12	200	0.105	0.250	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
13	PDB:6y5qq	0.162	0.415	2.372E-11	178	0.101	0.270	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
14	PDB:7oqcF	0.160	0.275	1.602E-10	267	0.082	0.146	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
15	PDB:6y53o	0.161	0.455	8.459E-10	160	0.086	0.256	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
16	PDB:6r5kH	0.154	0.183	3.629E-8	394	0.131	0.157	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
17	PDB:5lsbA	0.148	0.363	4.105E-8	176	0.095	0.256	5lsbA.pdb.gz
18	PDB:7dvqY	0.164	0.537	3.336E-7	140	0.053	0.179	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:6ff7X	0.153	0.398	5.136E-7	171	0.072	0.199	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
20	PDB:5yzg1	0.161	0.309	7.434E-7	243	0.067	0.132	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P26368	0.0	988	475	1.000	1.000	U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2 PE=1 SV=4
2	P26369	0.0	984	475	0.998	0.998	U2AF2_MOUSE Splicing factor U2AF 65 kDa subunit OS=Mus musculus OX=10090 GN=U2af2 PE=1 SV=3
3	Q24562	0.0	584	416	0.604	0.690	U2AF2_DROME Splicing factor U2AF 50 kDa subunit OS=Drosophila melanogaster OX=7227 GN=U2af50 PE=1 SV=1
4	P90978	8.40e-156	453	496	0.501	0.480	U2AF2_CAEEL Splicing factor U2AF 65 kDa subunit OS=Caenorhabditis elegans OX=6239 GN=uaf-1 PE=2 SV=2
5	Q9W1T4	2.82e-130	386	449	0.453	0.479	Q9W1T4_DROME Splicing factor U2AF subunit OS=Drosophila melanogaster OX=7227 GN=LS2 PE=1 SV=1
6	Q8T8Y4	1.20e-129	385	449	0.451	0.477	Q8T8Y4_DROME Splicing factor U2AF subunit OS=Drosophila melanogaster OX=7227 GN=LS2 PE=2 SV=1
7	Q8L716	1.95e-84	273	589	0.339	0.273	U2A2B_ARATH Splicing factor U2af large subunit B OS=Arabidopsis thaliana OX=3702 GN=U2AF65B PE=1 SV=2
8	F4JQG2	3.78e-84	271	551	0.394	0.339	F4JQG2_ARATH Splicing factor U2af large subunit OS=Arabidopsis thaliana OX=3702 GN=ATU2AF65A PE=1 SV=1
9	O23212	2.52e-82	267	573	0.318	0.264	U2A2A_ARATH Splicing factor U2af large subunit A OS=Arabidopsis thaliana OX=3702 GN=U2AF65A PE=1 SV=2
10	P36629	2.33e-46	170	517	0.272	0.250	U2AF2_SCHPO Splicing factor U2AF 59 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp2 PE=1 SV=1
11	P97343	6.68e-14	75.5	419	0.084	0.095	UHMK1_MOUSE Serine/threonine-protein kinase Kist OS=Mus musculus OX=10090 GN=Uhmk1 PE=1 SV=3
12	Q63285	7.05e-14	75.5	419	0.084	0.095	UHMK1_RAT Serine/threonine-protein kinase Kist OS=Rattus norvegicus OX=10116 GN=Uhmk1 PE=1 SV=1
13	Q9VM49	1.87e-13	74.7	594	0.124	0.099	Q9VM49_DROME Caper, isoform A OS=Drosophila melanogaster OX=7227 GN=Caper PE=1 SV=1
14	E9PQ56	2.76e-12	70.1	322	0.101	0.149	E9PQ56_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60 PE=1 SV=9
15	H0YEM1	4.10e-12	69.7	336	0.101	0.143	H0YEM1_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60 PE=1 SV=2
16	Q9UHX1	8.73e-12	69.7	559	0.101	0.086	PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60 PE=1 SV=1
17	O43040	2.99e-11	67.0	363	0.061	0.080	CTF1_SCHPO Cleavage and termination factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ctf1 PE=1 SV=1
18	F4ILE1	7.17e-11	66.6	610	0.124	0.097	F4ILE1_ARATH Splicing factor, CC1-like protein OS=Arabidopsis thaliana OX=3702 GN=At2g16940 PE=1 SV=1
19	Q8T6B9	1.07e-10	66.2	637	0.114	0.085	PUF68_DROME Poly(U)-binding-splicing factor half pint OS=Drosophila melanogaster OX=7227 GN=hfp PE=1 SV=2
20	Q9FGS0	1.48e-10	64.3	289	0.103	0.170	CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP31B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00586 AIRS	2.2e+02	13.6	AIR synthase related protein, N-terminal domain
2	PF00076 RRM_1	5.4e-31	117.6	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF16367 RRM_7	0.14	23.6	RNA recognition motif
4	PF16842 RRM_occluded	0.038	25.2	Occluded RNA-recognition motif
5	PF06495 Transformer	2.6	19.6	Fruit fly transformer protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9818.XP_007955472.1

Rank	PPI partner	STRING score	Description
1	9818.XP_007942992.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 9 Proteins
2	9818.XP_007936028.1	0.998	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 7 Proteins
3	9818.XP_007933618.1	0.993	Splicing factor 3B subunit 1 isoform X1
4	9818.XP_007949193.1	0.985	Splicing factor 3A subunit 2
5	9818.XP_007945453.1	0.984	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 7 Proteins
6	9818.XP_007953044.1	0.984	Splicing factor U2AF 26 kDa subunit
7	9818.XP_007947825.1	0.983	Serine/arginine-rich splicing factor 1 isoform X1
8	9818.XP_007949568.1	0.980	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 27 Proteins
9	9818.XP_007934373.1	0.977	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 11 Proteins
10	9818.XP_007941016.1	0.976	U1 small nuclear ribonucleoprotein 70 kDa
11	9818.XP_007947308.1	0.976	Transcription elongation regulator 1 isoform X1
12	9818.XP_007949114.1	0.975	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 5 bases at 5 genomic stop codons
13	9818.XP_007933438.1	0.972	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 12 Proteins
14	9818.XP_007932809.1	0.969	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 20 Proteins
15	9818.XP_007937551.1	0.968	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 11 Proteins
16	9818.XP_007955290.1	0.967	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 8 Proteins
17	9818.XP_007948348.1	0.965	pre-mRNA-processing factor 39
18	9818.XP_007943103.1	0.961	pre-mRNA-processing factor 19
19	9818.XP_007955326.1	0.952	U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2
20	9818.XP_007941164.1	0.951	U1 small nuclear ribonucleoprotein A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0019904	0.824	protein domain specific binding
GO:0036002	0.616	pre-mRNA binding
GO:0098772	0.537	molecular function regulator activity
GO:0019899	0.514	enzyme binding
GO:0003729	0.424	mRNA binding
GO:0140678	0.399	molecular function inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010467	0.997	gene expression
GO:0016070	0.997	RNA metabolic process
GO:0006396	0.994	RNA processing
GO:0050789	0.968	regulation of biological process
GO:0060255	0.937	regulation of macromolecule metabolic process
GO:0050794	0.922	regulation of cellular process
GO:0051171	0.897	regulation of nitrogen compound metabolic process
GO:0010468	0.894	regulation of gene expression
GO:0080090	0.893	regulation of primary metabolic process
GO:0031323	0.892	regulation of cellular metabolic process
GO:0019219	0.862	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.852	regulation of RNA metabolic process
GO:0008380	0.852	RNA splicing
GO:0006397	0.811	mRNA processing
GO:0000398	0.734	mRNA splicing, via spliceosome
GO:0048518	0.643	positive regulation of biological process
GO:0048522	0.582	positive regulation of cellular process
GO:0048519	0.446	negative regulation of biological process
GO:0010605	0.364	negative regulation of macromolecule metabolic process
GO:0048523	0.351	negative regulation of cellular process
GO:1903311	0.345	regulation of mRNA metabolic process
GO:0031324	0.344	negative regulation of cellular metabolic process
GO:0010604	0.343	positive regulation of macromolecule metabolic process
GO:0051172	0.341	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.985	protein-containing complex
GO:0016607	0.968	nuclear speck
GO:1990904	0.895	ribonucleoprotein complex
GO:0140513	0.852	nuclear protein-containing complex
GO:0005681	0.823	spliceosomal complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]