StarFunc result for job id P26374

User Input

>input (656 residues)
MADNLPTEFDVVIIGTGLPESILAAACSRSGQRVLHIDSRSYYGGNWASFSFSGLLSWLK
EYQQNNDIGEESTVVWQDLIHETEEAITLRKKDETIQHTEAFCYASQDMEDNVEEIGALQ
KNPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLEVTDVEESVEKEK
YCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITYSQIVKEGRRFNIDLVSKLLYS
QGLLIDLLIKSDVSRYVEFKNVTRILAFREGKVEQVPCSRADVFNSKELTMVEKRMLMKF
LTFCLEYEQHPDEYQAFRQCSFSEYLKTKKLTPNLQHFVLHSIAMTSESSCTTIDGLNAT
KNFLQCLGRFGNTPFLFPLYGQGEIPQGFCRMCAVFGGIYCLRHKVQCFVVDKESGRCKA
IIDHFGQRINAKYFIVEDSYLSEETCSNVQYKQISRAVLITDQSILKTDLDQQTSILIVP
PAEPGACAVRVTELCSSTMTCMKDTYLVHLTCSSSKTAREDLESVVKKLFTPYTETEINE
EELTKPRLLWALYFNMRDSSGISRSSYNGLPSNVYVCSGPDCGLGNEHAVKQAETLFQEI
FPTEEFCPPPPNPEDIIFDGDDKQPEAPGTNNVVMAKLESSEESKNLESPEKHLQN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P26374	1.000	1.000	0.000	656	1.000	1.000	P26374.pdb.gz	RAE2_HUMAN Rab proteins geranylgeranyltransferase component A 2 OS=Homo sapiens OX=9606 GN=CHML PE=1 SV=2
2	AFDB:P24386	0.825	0.829	4.203E-101	653	0.713	0.717	P24386.pdb.gz	RAE1_HUMAN Rab proteins geranylgeranyltransferase component A 1 OS=Homo sapiens OX=9606 GN=CHM PE=1 SV=3
3	AFDB:Q9QXG2	0.830	0.819	3.892E-98	665	0.675	0.666	Q9QXG2.pdb.gz	RAE1_MOUSE Rab proteins geranylgeranyltransferase component A 1 OS=Mus musculus OX=10090 GN=Chm PE=1 SV=1
4	AFDB:A8KBQ8	0.787	0.775	8.813E-84	666	0.540	0.532	A8KBQ8.pdb.gz
5	PDB:1vg9C	0.752	0.980	3.008E-81	502	0.622	0.813	1vg9C.pdb.gz	Structure of the Rab7:REP-1 complex: insights into the mechanism of Rab prenylation and choroideremia disease
6	PDB:2bcgG	0.553	0.796	1.824E-32	442	0.180	0.267	2bcgG.pdb.gz	Structure of doubly prenylated Ypt1:GDI complex and the mechanism of GDI-mediated Rab recycling
7	PDB:1lv0A	0.548	0.802	1.371E-28	433	0.169	0.256	1lv0A.pdb.gz	Geranylgeranyl switching regulates GDI-Rab GTPase recycling.
8	PDB:4dgkA	0.418	0.637	3.003E-12	405	0.090	0.146	4dgkA.pdb.gz
9	PDB:1o5wC	0.371	0.452	1.517E-9	512	0.101	0.129	1o5wC.pdb.gz	Structure of rat monoamine oxidase a and its specific recognitions for substrates and inhibitors.
10	PDB:2z5xA	0.388	0.473	2.358E-9	513	0.099	0.127	2z5xA.pdb.gz	Structure of human monoamine oxidase A at 2.2-A resolution: The control of opening the entry for substrates/inhibitors
11	PDB:4gdpB	0.364	0.449	1.621E-8	502	0.104	0.135	4gdpB.pdb.gz	Mechanistic and Structural Analyses of the Roles of Active Site Residues in Yeast Polyamine Oxidase Fms1: Characterization of the N195A and D94N Enzymes.
12	PDB:6fvzA	0.383	0.475	2.813E-8	500	0.101	0.132	6fvzA.pdb.gz	Tight-Binding Inhibition of Human Monoamine Oxidase B by Chromone Analogs: A Kinetic, Crystallographic, and Biological Analysis.
13	PDB:3nksA	0.371	0.493	4.879E-8	465	0.084	0.118	3nksA.pdb.gz	Structural insight into human variegate porphyria disease
14	PDB:1rsgA	0.353	0.452	2.411E-7	481	0.102	0.139	1rsgA.pdb.gz	Crystal structures of fms1 and its complex with spermine reveal substrate specificity.
15	AFDB:E9PII3	0.069	0.063	9.112E-2	706	0.133	0.123	E9PII3.pdb.gz	E9PII3_HUMAN Erythrocyte membrane protein band 4.1 like 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
16	AFDB:O70173	0.075	0.043	4.078	1505	0.117	0.051	O70173.pdb.gz	P3C2G_RAT Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma OS=Rattus norvegicus OX=10116 GN=Pik3c2g PE=1 SV=1
17	AFDB:Q54S40	0.078	0.049	5.675	1312	0.053	0.027	Q54S40.pdb.gz	GBPD_DICDI Cyclic GMP-binding protein D OS=Dictyostelium discoideum OX=44689 GN=gbpD PE=2 SV=1
18	AFDB:F1QUT1	0.063	0.035	9.845	1399	0.113	0.053	F1QUT1.pdb.gz	F1QUT1_DANRE Period circadian clock 2 OS=Danio rerio OX=7955 GN=fj43b09 PE=4 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P24386	0.0	967	653	0.715	0.718	RAE1_HUMAN Rab proteins geranylgeranyltransferase component A 1 OS=Homo sapiens OX=9606 GN=CHM PE=1 SV=3
2	P26374	0.0	1366	656	1.000	1.000	RAE2_HUMAN Rab proteins geranylgeranyltransferase component A 2 OS=Homo sapiens OX=9606 GN=CHML PE=1 SV=2
3	P37727	0.0	926	650	0.691	0.697	RAE1_RAT Rab proteins geranylgeranyltransferase component A 1 OS=Rattus norvegicus OX=10116 GN=Chm PE=1 SV=1
4	Q6RFG0	0.0	686	666	0.540	0.532	Q6RFG0_DANRE Rab proteins geranylgeranyltransferase component A OS=Danio rerio OX=7955 GN=eva PE=1 SV=1
5	Q9QXG2	0.0	899	665	0.668	0.659	RAE1_MOUSE Rab proteins geranylgeranyltransferase component A 1 OS=Mus musculus OX=10090 GN=Chm PE=1 SV=1
6	Q9V8W3	1.42e-69	237	511	0.212	0.272	RABEP_DROME Rab proteins geranylgeranyltransferase component A OS=Drosophila melanogaster OX=7227 GN=Rep PE=1 SV=1
7	Q8LLD4	3.63e-38	151	563	0.181	0.211	REP_ARATH Rab escort protein 1 OS=Arabidopsis thaliana OX=3702 GN=REP PE=1 SV=2
8	P39958	2.65e-33	135	451	0.139	0.202	GDI1_YEAST Rab GDP-dissociation inhibitor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GDI1 PE=1 SV=1
9	Q9VLB7	1.41e-32	133	443	0.125	0.185	Q9VLB7_DROME Rab GDP dissociation inhibitor OS=Drosophila melanogaster OX=7227 GN=Gdi PE=1 SV=1
10	Q9LXC0	2.78e-32	132	445	0.120	0.178	GDI_ARATH Guanosine nucleotide diphosphate dissociation inhibitor At5g09550 OS=Arabidopsis thaliana OX=3702 GN=At5g09550 PE=3 SV=1
11	B5X1S6	4.88e-32	131	448	0.119	0.174	B5X1S6_SALSA Rab GDP dissociation inhibitor OS=Salmo salar OX=8030 GN=GDIB PE=2 SV=1
12	P50399	8.90e-32	130	445	0.117	0.173	GDIB_RAT Rab GDP dissociation inhibitor beta OS=Rattus norvegicus OX=10116 GN=Gdi2 PE=1 SV=2
13	Q61598	8.90e-32	130	445	0.117	0.173	GDIB_MOUSE Rab GDP dissociation inhibitor beta OS=Mus musculus OX=10090 GN=Gdi2 PE=1 SV=1
14	P50396	4.91e-31	128	447	0.114	0.168	GDIA_MOUSE Rab GDP dissociation inhibitor alpha OS=Mus musculus OX=10090 GN=Gdi1 PE=1 SV=3
15	P21856	5.35e-31	128	447	0.114	0.168	GDIA_BOVIN Rab GDP dissociation inhibitor alpha OS=Bos taurus OX=9913 GN=GDI1 PE=1 SV=1
16	P50398	5.61e-31	128	447	0.114	0.168	GDIA_RAT Rab GDP dissociation inhibitor alpha OS=Rattus norvegicus OX=10116 GN=Gdi1 PE=1 SV=1
17	P31150	9.87e-31	127	447	0.114	0.168	GDIA_HUMAN Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2
18	Q96254	1.17e-30	127	445	0.119	0.175	GDI1_ARATH Guanosine nucleotide diphosphate dissociation inhibitor 1 OS=Arabidopsis thaliana OX=3702 GN=GDI1 PE=1 SV=1
19	O24653	2.29e-30	126	444	0.119	0.176	GDI2_ARATH Guanosine nucleotide diphosphate dissociation inhibitor 2 OS=Arabidopsis thaliana OX=3702 GN=GDI2 PE=2 SV=1
20	Q24349	3.62e-30	126	448	0.122	0.179	Q24349_DROME Rab GDP dissociation inhibitor OS=Drosophila melanogaster OX=7227 GN=Gdi PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00890 FAD_binding_2	14	16.2	FAD binding domain
2	PF12831 FAD_oxidored	17	16.2	FAD dependent oxidoreductase
3	PF00996 GDI	6.2e-55	198.1	GDP dissociation inhibitor
4	PF13450 NAD_binding_8	2.6	19.7	NAD(P)-binding Rossmann-like domain
5	PF04433 SWIRM	2.8e+02	13.3	SWIRM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355511

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382341	0.978	Geranylgeranyl transferase type-2 subunit alpha
2	9606.ENSP00000273047	0.967	Ras-related protein Rab-5A
3	9606.ENSP00000317473	0.958	Geranylgeranyl transferase type-2 subunit beta
4	9606.ENSP00000387286	0.946	Ras-related protein Rab-1A
5	9606.ENSP00000379601	0.944	Ras-related protein Rab-27A
6	9606.ENSP00000265062	0.939	Ras-related protein Rab-7a
7	9606.ENSP00000411418	0.932	Rab3 GTPase-activating protein catalytic subunit
8	9606.ENSP00000351832	0.929	Rab3 GTPase-activating protein non-catalytic subunit
9	9606.ENSP00000370208	0.923	RAB guanine nucleotide exchange factor 1
10	9606.ENSP00000447300	0.923	Rab-3A-interacting protein
11	9606.ENSP00000433528	0.920	Suppression of tumorigenicity 5 protein
12	9606.ENSP00000377664	0.917	GTPase-activating protein and VPS9 domain-containing protein 1
13	9606.ENSP00000394071	0.917	Rab GDP dissociation inhibitor alpha
14	9606.ENSP00000310226	0.916	Ras-related protein Rab-1B
15	9606.ENSP00000369538	0.914	Rab GDP dissociation inhibitor beta
16	9606.ENSP00000248248	0.912	MON1 homolog B, secretory trafficking associated
17	9606.ENSP00000296473	0.912	Vacuolar fusion protein MON1 homolog A
18	9606.ENSP00000470262	0.912	Trafficking protein particle complex subunit 5
19	9606.ENSP00000255006	0.911	Ras and Rab interactor 2
20	9606.ENSP00000302783	0.911	Trafficking protein particle complex subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031267	1.000	small GTPase binding
GO:0003824	0.971	catalytic activity
GO:0140096	0.792	catalytic activity, acting on a protein
GO:0016740	0.689	transferase activity
GO:0016765	0.678	transferase activity, transferring alkyl or aryl (other than methyl) groups
GO:0008318	0.589	protein prenyltransferase activity
GO:0004661	0.575	protein geranylgeranyltransferase activity
GO:0004663	0.569	Rab geranylgeranyltransferase activity
GO:0044877	0.302	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0008152	0.951	metabolic process
GO:0043170	0.936	macromolecule metabolic process
GO:0043412	0.932	macromolecule modification
GO:1901564	0.918	organonitrogen compound metabolic process
GO:0044238	0.883	primary metabolic process
GO:0019538	0.823	protein metabolic process
GO:0044237	0.784	cellular metabolic process
GO:0036211	0.776	protein modification process
GO:0065007	0.480	biological regulation
GO:0051179	0.470	localization
GO:0050794	0.437	regulation of cellular process
GO:0006810	0.437	transport
GO:0051641	0.341	cellular localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:1990234	0.998	transferase complex
GO:0070013	0.986	intracellular organelle lumen
GO:0005654	0.968	nucleoplasm
GO:0005968	0.730	Rab-protein geranylgeranyltransferase complex
GO:0012505	0.460	endomembrane system
GO:0016020	0.368	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.689	Transferases.
EC:2.5.1.-	0.678	Transferring alkyl or aryl groups, other than methyl groups.
EC:2.5.1.60	0.569	protein geranylgeranyltransferase type II.

[back to server]