StarFunc result for job id P26441

User Input

>input (200 residues)
MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVAS
TDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFA
YQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFIS
SHQTGIPARGSHYIANNKKM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P26441	1.000	1.000	2.487E-26	200	1.000	1.000	P26441.pdb.gz	CNTF_HUMAN Ciliary neurotrophic factor OS=Homo sapiens OX=9606 GN=CNTF PE=1 SV=1
2	AFDB:P20294	0.899	0.899	2.680E-21	200	0.840	0.840	P20294.pdb.gz	CNTF_RAT Ciliary neurotrophic factor OS=Rattus norvegicus OX=10116 GN=Cntf PE=1 SV=1
3	PDB:1cnt1	0.716	0.949	1.368E-14	150	0.750	1.000	1cnt1.pdb.gz
4	PDB:1cnt2	0.619	0.942	1.202E-11	130	0.645	0.992	1cnt2.pdb.gz
5	AFDB:P83714	0.772	0.758	4.474E-7	204	0.200	0.196	P83714.pdb.gz	CTF2_MOUSE Cardiotrophin-2 OS=Mus musculus OX=10090 GN=Ctf2 PE=1 SV=1
6	AFDB:Q60753	0.724	0.714	1.008E-5	203	0.200	0.197	Q60753.pdb.gz	CTF1_MOUSE Cardiotrophin-1 OS=Mus musculus OX=10090 GN=Ctf1 PE=2 SV=1
7	AFDB:Q16619	0.705	0.702	2.519E-5	201	0.215	0.214	Q16619.pdb.gz	CTF1_HUMAN Cardiotrophin-1 OS=Homo sapiens OX=9606 GN=CTF1 PE=1 SV=1
8	AFDB:Q9QZM3	0.722	0.647	4.569E-5	225	0.190	0.169	Q9QZM3.pdb.gz	CLCF1_MOUSE Cardiotrophin-like cytokine factor 1 OS=Mus musculus OX=10090 GN=Clcf1 PE=1 SV=1
9	AFDB:Q8NEV9	0.671	0.561	1.042E-4	243	0.200	0.165	Q8NEV9.pdb.gz	IL27A_HUMAN Interleukin-27 subunit alpha OS=Homo sapiens OX=9606 GN=IL27 PE=1 SV=2
10	AFDB:Q8K3I6	0.688	0.596	1.574E-4	234	0.205	0.175	Q8K3I6.pdb.gz	IL27A_MOUSE Interleukin-27 subunit alpha OS=Mus musculus OX=10090 GN=Il27 PE=1 SV=1
11	PDB:7z0lB	0.648	0.368	2.883E-4	370	0.175	0.095	7z0lB.pdb.gz
12	AFDB:D3ZPW3	0.667	0.577	3.589E-4	234	0.185	0.158	D3ZPW3.pdb.gz	D3ZPW3_RAT Interleukin 27 OS=Rattus norvegicus OX=10116 GN=Il27 PE=4 SV=1
13	AFDB:P20809	0.678	0.681	6.814E-4	199	0.145	0.146	P20809.pdb.gz	IL11_HUMAN Interleukin-11 OS=Homo sapiens OX=9606 GN=IL11 PE=1 SV=1
14	PDB:7u7nD	0.691	0.720	9.928E-4	191	0.185	0.194	7u7nD.pdb.gz
15	PDB:6o4oA	0.588	0.676	1.499E-3	169	0.130	0.154	6o4oA.pdb.gz
16	PDB:7zxkC	0.643	0.763	2.847E-3	166	0.170	0.205	7zxkC.pdb.gz
17	PDB:1rw5A	0.506	0.508	4.107E-3	199	0.120	0.121	1rw5A.pdb.gz
18	PDB:2q7nB	0.591	0.649	8.546E-3	180	0.150	0.167	2q7nB.pdb.gz
19	PDB:1rhgB	0.539	0.725	8.946E-3	144	0.180	0.250	1rhgB.pdb.gz
20	PDB:1huwA	0.411	0.480	1.550E-2	166	0.100	0.120	1huwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P26441	7.96e-151	417	200	1.000	1.000	CNTF_HUMAN Ciliary neurotrophic factor OS=Homo sapiens OX=9606 GN=CNTF PE=1 SV=1
2	P20294	9.00e-126	354	200	0.840	0.840	CNTF_RAT Ciliary neurotrophic factor OS=Rattus norvegicus OX=10116 GN=Cntf PE=1 SV=1
3	P51642	9.17e-121	342	198	0.810	0.818	CNTF_MOUSE Ciliary neurotrophic factor OS=Mus musculus OX=10090 GN=Cntf PE=2 SV=1
4	P83714	1.91e-04	43.1	204	0.205	0.201	CTF2_MOUSE Cardiotrophin-2 OS=Mus musculus OX=10090 GN=Ctf2 PE=1 SV=1
5	B5L332	0.25	33.5	185	0.120	0.130	B5L332_DANRE CSF3 OS=Danio rerio OX=7955 GN=csf3 PE=2 SV=1
6	P00480	0.30	33.9	354	0.100	0.056	OTC_HUMAN Ornithine transcarbamylase, mitochondrial OS=Homo sapiens OX=9606 GN=OTC PE=1 SV=3
7	P11725	3.4	30.8	354	0.085	0.048	OTC_MOUSE Ornithine transcarbamylase, mitochondrial OS=Mus musculus OX=10090 GN=Otc PE=1 SV=1
8	P00481	3.9	30.4	354	0.085	0.048	OTC_RAT Ornithine transcarbamylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Otc PE=1 SV=1
9	Q9N3F1	3.9	30.0	180	0.060	0.067	DCTN6_CAEEL Dynactin subunit 6 OS=Caenorhabditis elegans OX=6239 GN=dnc-6 PE=3 SV=2
10	Q9YHY9	4.7	30.4	354	0.085	0.048	OTC_CHICK Ornithine transcarbamylase, mitochondrial OS=Gallus gallus OX=9031 GN=OTC PE=1 SV=1
11	Q9Y574	5.4	30.0	426	0.115	0.054	ASB4_HUMAN Ankyrin repeat and SOCS box protein 4 OS=Homo sapiens OX=9606 GN=ASB4 PE=1 SV=1
12	Q8IY92	5.5	30.4	1834	0.065	0.007	SLX4_HUMAN Structure-specific endonuclease subunit SLX4 OS=Homo sapiens OX=9606 GN=SLX4 PE=1 SV=3
13	Q60753	6.3	29.6	203	0.185	0.182	CTF1_MOUSE Cardiotrophin-1 OS=Mus musculus OX=10090 GN=Ctf1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01110 CNTF	3.3e-106	364.4	Ciliary neurotrophic factor
2	PF12516 DUF3719	1.7e+02	13.3	Protein of unknown function (DUF3719)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355370

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263409	0.999	Leukemia inhibitory factor receptor
2	9606.ENSP00000368265	0.999	Ciliary neurotrophic factor receptor subunit alpha
3	9606.ENSP00000370698	0.985	Interleukin-6 receptor subunit beta
4	9606.ENSP00000414303	0.945	Brain-derived neurotrophic factor
5	9606.ENSP00000357470	0.928	Interleukin-6 receptor subunit alpha
6	9606.ENSP00000249075	0.917	Leukemia inhibitory factor
7	9606.ENSP00000312652	0.903	Leptin
8	9606.ENSP00000252723	0.882	Erythropoietin
9	9606.ENSP00000225474	0.875	Granulocyte colony-stimulating factor
10	9606.ENSP00000263379	0.872	Interleukin-27 receptor subunit alpha
11	9606.ENSP00000409007	0.863	Glial cell line-derived neurotrophic factor
12	9606.ENSP00000385675	0.856	Interleukin-6
13	9606.ENSP00000302150	0.852	Prolactin
14	9606.ENSP00000358525	0.850	Beta-nerve growth factor
15	9606.ENSP00000309338	0.845	Cardiotrophin-like cytokine factor 1
16	9606.ENSP00000279804	0.844	Cardiotrophin-1
17	9606.ENSP00000376188	0.832	Cytokine receptor-like factor 1
18	9606.ENSP00000204615	0.831	Thrombopoietin
19	9606.ENSP00000312673	0.817	Somatotropin
20	9606.ENSP00000215781	0.807	Oncostatin-M

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005127	1.000	ciliary neurotrophic factor receptor binding
GO:0008083	1.000	growth factor activity
GO:0070851	0.979	growth factor receptor binding
GO:0005138	0.732	interleukin-6 receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0007165	0.989	signal transduction
GO:0051173	0.988	positive regulation of nitrogen compound metabolic process
GO:0010604	0.988	positive regulation of macromolecule metabolic process
GO:0031325	0.988	positive regulation of cellular metabolic process
GO:0080090	0.987	regulation of primary metabolic process
GO:0050731	0.984	positive regulation of peptidyl-tyrosine phosphorylation
GO:0007166	0.981	cell surface receptor signaling pathway
GO:0010941	0.980	regulation of cell death
GO:0042509	0.970	regulation of tyrosine phosphorylation of STAT protein
GO:0048523	0.955	negative regulation of cellular process
GO:0042531	0.946	positive regulation of tyrosine phosphorylation of STAT protein
GO:0043067	0.945	regulation of programmed cell death
GO:0060548	0.944	negative regulation of cell death
GO:1901214	0.930	regulation of neuron death
GO:0048856	0.885	anatomical structure development
GO:0032501	0.882	multicellular organismal process
GO:0043066	0.881	negative regulation of apoptotic process
GO:0034097	0.873	response to cytokine
GO:1901215	0.815	negative regulation of neuron death
GO:0043524	0.790	negative regulation of neuron apoptotic process
GO:0010468	0.734	regulation of gene expression
GO:0007275	0.726	multicellular organism development
GO:0048731	0.701	system development
GO:0042127	0.698	regulation of cell population proliferation
GO:0008284	0.691	positive regulation of cell population proliferation
GO:0048583	0.675	regulation of response to stimulus
GO:0071345	0.674	cellular response to cytokine stimulus
GO:0050793	0.667	regulation of developmental process
GO:0051239	0.643	regulation of multicellular organismal process
GO:0010628	0.598	positive regulation of gene expression
GO:0023051	0.533	regulation of signaling
GO:0010646	0.533	regulation of cell communication
GO:0009966	0.517	regulation of signal transduction
GO:0048584	0.500	positive regulation of response to stimulus
GO:0009967	0.486	positive regulation of signal transduction
GO:0019221	0.404	cytokine-mediated signaling pathway
GO:0007399	0.394	nervous system development
GO:0030154	0.393	cell differentiation
GO:0045595	0.363	regulation of cell differentiation
GO:1902533	0.329	positive regulation of intracellular signal transduction
GO:0051240	0.317	positive regulation of multicellular organismal process
GO:0097696	0.309	receptor signaling pathway via STAT

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0005622	0.704	intracellular anatomical structure
GO:0043227	0.686	membrane-bounded organelle
GO:0043229	0.686	intracellular organelle
GO:0005737	0.634	cytoplasm
GO:0016020	0.391	membrane
GO:0043231	0.364	intracellular membrane-bounded organelle
GO:0005829	0.309	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]