StarFunc result for job id P26572

User Input

>input (445 residues)
MLKKQSAGLVLWGAILFVAWNALLLLFFWTRPAPGRPPSVSALDGDPASLTREVIRLAQD
AEVELERQRGLLQQIGDALSSQRGRVPTAAPPAQPRVPVTPAPAVIPILVIACDRSTVRR
CLDKLLHYRPSAELFPIIVSQDCGHEETAQAIASYGSAVTHIRQPDLSSIAVPPDHRKFQ
GYYKIARHYRWALGQVFRQFRFPAAVVVEDDLEVAPDFFEYFRATYPLLKADPSLWCVSA
WNDNGKEQMVDASRPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRQG
RACIRPEISRTMTFGRKGVSHGQFFDQHLKFIKLNQQFVHFTQLDLSYLQREAYDRDFLA
RVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIV
TFQFRGRRVHLAPPLTWEGYDPSWN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P27115	0.861	0.857	5.838E-90	447	0.928	0.924	P27115.pdb.gz	MGAT1_RABIT Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Oryctolagus cuniculus OX=9986 GN=MGAT1 PE=1 SV=1
2	AFDB:Q60GL7	0.767	0.746	6.751E-62	458	0.501	0.487	Q60GL7.pdb.gz	Q60GL7_DROME Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Drosophila melanogaster OX=7227 GN=Mgat1 PE=2 SV=1
3	AFDB:Q11068	0.757	0.750	2.105E-51	449	0.369	0.365	Q11068.pdb.gz	MGAT1_CAEEL Putative alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-13 PE=2 SV=2
4	AFDB:G5EFK6	0.755	0.769	7.131E-51	437	0.380	0.387	G5EFK6.pdb.gz	G5EFK6_CAEEL Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-14 PE=2 SV=1
5	AFDB:Q9XGM8	0.710	0.712	4.899E-44	444	0.337	0.338	Q9XGM8.pdb.gz	MGAT1_ARATH Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Arabidopsis thaliana OX=3702 GN=GNTI PE=1 SV=1
6	AFDB:G5EBG7	0.721	0.688	2.748E-42	467	0.310	0.296	G5EBG7.pdb.gz	G5EBG7_CAEEL Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-12 PE=1 SV=1
7	AFDB:Q8WZA1	0.627	0.430	8.219E-27	660	0.243	0.164	Q8WZA1.pdb.gz	PMGT1_HUMAN Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=POMGNT1 PE=1 SV=2
8	AFDB:Q09326	0.360	0.362	1.629E-10	442	0.151	0.152	Q09326.pdb.gz	MGAT2_RAT Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=Mgat2 PE=1 SV=1
9	AFDB:Q10469	0.376	0.374	4.069E-10	447	0.121	0.121	Q10469.pdb.gz	MGAT2_HUMAN Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=MGAT2 PE=1 SV=1
10	PDB:5vcmB	0.388	0.472	6.692E-10	358	0.103	0.128	5vcmB.pdb.gz	HumanN-acetylglucosaminyltransferase II substrate recognition uses a modular architecture that includes a convergent exosite.
11	PDB:5vcsB	0.359	0.483	1.479E-9	323	0.099	0.136	5vcsB.pdb.gz	HumanN-acetylglucosaminyltransferase II substrate recognition uses a modular architecture that includes a convergent exosite.
12	AFDB:Q9BRR3	0.368	0.402	9.290E-8	403	0.072	0.079	Q9BRR3.pdb.gz	PGAP4_HUMAN Post-GPI attachment to proteins factor 4 OS=Homo sapiens OX=9606 GN=PGAP4 PE=1 SV=1
13	PDB:4fixA	0.281	0.212	1.982E-6	629	0.088	0.062	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
14	PDB:6iwqA	0.329	0.273	3.087E-5	546	0.079	0.064	6iwqA.pdb.gz	Structural basis of carbohydrate transfer activity of UDP-GalNAc: Polypeptide N-acetylgalactosaminyltransferase 7.
15	PDB:6fxrA	0.296	0.201	9.257E-5	700	0.067	0.043	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
16	PDB:4decA	0.263	0.395	1.046E-4	284	0.061	0.095	4decA.pdb.gz	Mechanistic insights into the retaining glucosyl-3-phosphoglycerate synthase from mycobacteria.
17	PDB:1ll0B	0.239	0.368	1.419E-4	267	0.054	0.090	1ll0B.pdb.gz
18	PDB:4d11C	0.360	0.367	1.508E-4	436	0.081	0.083	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
19	PDB:4d0tA	0.360	0.326	2.312E-4	496	0.092	0.083	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
20	PDB:2bo6A	0.254	0.292	5.111E-4	380	0.049	0.058	2bo6A.pdb.gz	Structural Dissection and High-Throughput Screening of Mannosylglyceerate Synthase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P26572	0.0	909	445	1.000	1.000	MGAT1_HUMAN Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=MGAT1 PE=1 SV=2
2	P27115	0.0	812	447	0.928	0.924	MGAT1_RABIT Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Oryctolagus cuniculus OX=9986 GN=MGAT1 PE=1 SV=1
3	P27808	0.0	823	447	0.903	0.899	MGAT1_MOUSE Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=Mgat1 PE=1 SV=1
4	P70680	0.0	836	447	0.912	0.908	P70680_CRIGR Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Cricetulus griseus OX=10029 PE=2 SV=1
5	Q60GL7	2.20e-157	454	458	0.499	0.485	Q60GL7_DROME Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Drosophila melanogaster OX=7227 GN=Mgat1 PE=2 SV=1
6	Q9NGK4	6.01e-155	448	456	0.497	0.485	Q9NGK4_DROME Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Drosophila melanogaster OX=7227 GN=Mgat1 PE=2 SV=1
7	Q11068	8.62e-108	328	449	0.348	0.345	MGAT1_CAEEL Putative alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-13 PE=2 SV=2
8	G5EFK6	5.41e-106	323	437	0.353	0.359	G5EFK6_CAEEL Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-14 PE=2 SV=1
9	Q9XGM8	1.47e-81	260	444	0.330	0.331	MGAT1_ARATH Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Arabidopsis thaliana OX=3702 GN=GNTI PE=1 SV=1
10	G5EBG7	1.82e-73	240	467	0.292	0.278	G5EBG7_CAEEL Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-12 PE=1 SV=1
11	Q91X88	7.76e-36	142	660	0.261	0.176	PMGT1_MOUSE Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Mus musculus OX=10090 GN=Pomgnt1 PE=1 SV=1
12	Q8WZA1	1.30e-35	141	660	0.261	0.176	PMGT1_HUMAN Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=POMGNT1 PE=1 SV=2
13	A4K8J2	0.14	36.2	244	0.061	0.111	A4K8J2_DANRE Insulin-like growth factor-binding protein 1 OS=Danio rerio OX=7955 GN=igfbp1b PE=2 SV=1
14	A4IGH0	0.15	36.6	265	0.061	0.102	A4IGH0_DANRE Insulin-like growth factor-binding protein 1 (Fragment) OS=Danio rerio OX=7955 GN=igfbp1b PE=2 SV=1
15	A0A1D8PMR7	1.7	33.5	519	0.056	0.048	A0A1D8PMR7_CANAL Cytochrome P450 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C407040WA PE=3 SV=1
16	Q14680	1.9	33.5	651	0.045	0.031	MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens OX=9606 GN=MELK PE=1 SV=3
17	Q9LFT8	8.1	31.2	505	0.074	0.065	CDKC1_ARATH Cyclin-dependent kinase C-1 OS=Arabidopsis thaliana OX=3702 GN=CDKC-1 PE=1 SV=1
18	Q9UGM3	8.9	31.6	2413	0.031	0.006	DMBT1_HUMAN Deleted in malignant brain tumors 1 protein OS=Homo sapiens OX=9606 GN=DMBT1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13641 Glyco_tranf_2_3	43	15.4	Glycosyltransferase like family 2
2	PF03071 GNT-I	5.4e-223	752.2	GNT-I family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000404718

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261483	0.983	Alpha-mannosidase 2
2	9606.ENSP00000452948	0.981	Alpha-mannosidase 2x
3	9606.ENSP00000307423	0.970	Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
4	9606.ENSP00000357453	0.969	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA
5	9606.ENSP00000348959	0.960	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB
6	9606.ENSP00000363452	0.940	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC
7	9606.ENSP00000322270	0.905	Adhesion G protein-coupled receptor L2
8	9606.ENSP00000386377	0.789	Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A
9	9606.ENSP00000258052	0.788	Sphingomyelin phosphodiesterase 2
10	9606.ENSP00000353910	0.761	Alpha-(1,6)-fucosyltransferase
11	9606.ENSP00000482264	0.726	Diacylglycerol O-acyltransferase 1
12	9606.ENSP00000228027	0.722	Diacylglycerol O-acyltransferase 2
13	9606.ENSP00000345270	0.720	Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
14	9606.ENSP00000380793	0.688	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
15	9606.ENSP00000264968	0.642	Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A
16	9606.ENSP00000360645	0.642	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase
17	9606.ENSP00000369055	0.639	Beta-1,4-galactosyltransferase 1
18	9606.ENSP00000395473	0.635	Lysosomal alpha-mannosidase
19	9606.ENSP00000338487	0.618	Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B
20	9606.ENSP00000389176	0.612	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140096	0.999	catalytic activity, acting on a protein
GO:0008375	0.999	acetylglucosaminyltransferase activity
GO:0140103	0.993	catalytic activity, acting on a glycoprotein
GO:0003827	0.933	alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity
GO:0005488	0.761	binding
GO:0016262	0.721	protein N-acetylglucosaminyltransferase activity
GO:0005515	0.711	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:1901576	0.997	organic substance biosynthetic process
GO:1901564	0.997	organonitrogen compound metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0044249	0.995	cellular biosynthetic process
GO:0006486	0.992	protein glycosylation
GO:0006487	0.887	protein N-linked glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0016020	0.999	membrane
GO:0031090	0.990	organelle membrane
GO:0005576	0.984	extracellular region
GO:0000139	0.976	Golgi membrane
GO:0005615	0.936	extracellular space
GO:1903561	0.910	extracellular vesicle
GO:0070062	0.891	extracellular exosome
GO:0031984	0.887	organelle subcompartment
GO:0098791	0.790	Golgi apparatus subcompartment
GO:0005795	0.581	Golgi stack
GO:0005797	0.408	Golgi medial cisterna
GO:0043233	0.349	organelle lumen
GO:0070013	0.308	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	0.999	Hexosyltransferases.
RHEA:11456	0.933	N(4)-(alpha-D-Man-(1->3)-[alpha-D-Man-(1->3)-[alpha-D-Man-(1->6)]-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc)-L-asparaginyl-[protein] (N-glucan mannose isomer 5A1,2) + UDP-N-acetyl-alpha-D-glucosamine = H(+) + N(4)-{beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->3)-[alpha-D-Man-(1->6)]-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc}-L-asparaginyl-[protein] + UDP
EC:2.4.1.101	0.933	alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase.
RHEA:16533	0.721	L-asparaginyl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = H(+) + N(4)-(N-acetyl-beta-D-glucosaminyl)-L-asparaginyl-[protein] + UDP
EC:2.4.1.94	0.721	protein N-acetylglucosaminyltransferase.

[back to server]