StarFunc result for job id P26583

User Input

>input (209 residues)
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKF
EDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGL
SIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTG
SKKKNEPEDEEEEEEEEDEDEEEEDEDEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1RJ01	0.560	0.557	1.201E-26	210	0.990	0.986	F1RJ01.pdb.gz	F1RJ01_PIG High mobility group box 2 OS=Sus scrofa OX=9823 GN=HMGB2 PE=3 SV=3
2	AFDB:P09429	0.413	0.402	3.083E-22	215	0.713	0.693	P09429.pdb.gz	HMGB1_HUMAN High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3
3	AFDB:Q6NX86	0.418	0.426	5.836E-22	205	0.722	0.737	Q6NX86.pdb.gz	Q6NX86_DANRE High mobility group box 1a OS=Danio rerio OX=7955 GN=HMGB1 PE=1 SV=1
4	AFDB:F2Z594	0.461	0.440	7.801E-22	220	0.713	0.677	F2Z594.pdb.gz	F2Z594_PIG High mobility group protein B1 OS=Sus scrofa OX=9823 GN=HMGB1 PE=1 SV=3
5	AFDB:X2JGB1	0.476	0.471	7.496E-21	212	0.737	0.726	X2JGB1.pdb.gz	X2JGB1_CYNSE Putative high mobility group B2 protein OS=Cynoglossus semilaevis OX=244447 GN=HMGB2 PE=2 SV=1
6	AFDB:P07746	0.408	0.418	1.419E-20	204	0.617	0.632	P07746.pdb.gz	HMGT_ONCMY High mobility group-T protein OS=Oncorhynchus mykiss OX=8022 PE=2 SV=2
7	AFDB:P40618	0.409	0.422	3.805E-20	202	0.622	0.644	P40618.pdb.gz	HMGB3_CHICK High mobility group protein B3 OS=Gallus gallus OX=9031 GN=HMGB3 PE=2 SV=3
8	AFDB:Q8WW32	0.523	0.577	1.494E-14	186	0.359	0.403	Q8WW32.pdb.gz	HMGB4_HUMAN High mobility group protein B4 OS=Homo sapiens OX=9606 GN=HMGB4 PE=1 SV=2
9	AFDB:Q24537	0.384	0.245	1.583E-14	393	0.459	0.244	Q24537.pdb.gz	HMG2_DROME High mobility group protein DSP1 OS=Drosophila melanogaster OX=7227 GN=Dsp1 PE=2 SV=1
10	AFDB:P23497	0.388	0.099	1.278E-13	879	0.541	0.129	P23497.pdb.gz	SP100_HUMAN Nuclear autoantigen Sp-100 OS=Homo sapiens OX=9606 GN=SP100 PE=1 SV=3
11	PDB:1j5nA	0.341	0.710	1.959E-4	93	0.187	0.419	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
12	PDB:7ploI	0.223	0.106	3.696E-1	451	0.072	0.033	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
13	PDB:6zm7CE	0.178	0.297	1.180	124	0.086	0.145	6zm7CE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
14	PDB:7pj1B	0.146	0.235	1.771	122	0.086	0.148	7pj1B.pdb.gz
15	PDB:7qsmW	0.146	0.236	2.658	116	0.062	0.112	7qsmW.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
16	PDB:8ap8h	0.134	0.172	2.816	137	0.091	0.139	8ap8h.pdb.gz
17	PDB:1kw2A	0.144	0.068	3.163	455	0.057	0.026	1kw2A.pdb.gz
18	PDB:6gejG	0.107	0.214	5.031	96	0.081	0.177	6gejG.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
19	PDB:7b5sH	0.113	0.110	5.031	216	0.120	0.116	7b5sH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
20	PDB:2j3tD	0.138	0.138	5.332	210	0.043	0.043	2j3tD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P26583	8.08e-149	413	209	1.000	1.000	HMGB2_HUMAN High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2
2	P40673	8.08e-149	413	209	1.000	1.000	HMGB2_BOVIN High mobility group protein B2 OS=Bos taurus OX=9913 GN=HMGB2 PE=1 SV=3
3	Q5U071	3.52e-146	407	208	0.995	1.000	Q5U071_HUMAN High-mobility group box 2 OS=Homo sapiens OX=9606 PE=2 SV=1
4	P17741	3.95e-146	407	210	0.995	0.990	HMGB2_PIG High mobility group protein B2 OS=Sus scrofa OX=9823 GN=HMGB2 PE=1 SV=2
5	P52925	5.67e-146	406	210	0.990	0.986	HMGB2_RAT High mobility group protein B2 OS=Rattus norvegicus OX=10116 GN=Hmgb2 PE=2 SV=2
6	F1RJ01	2.44e-145	404	210	0.990	0.986	F1RJ01_PIG High mobility group box 2 OS=Sus scrofa OX=9823 GN=HMGB2 PE=3 SV=3
7	Q3U566	3.11e-143	399	210	0.976	0.971	Q3U566_MOUSE HMG box domain-containing protein OS=Mus musculus OX=10090 GN=Hmgb2 PE=2 SV=1
8	P30681	9.63e-143	398	210	0.971	0.967	HMGB2_MOUSE High mobility group protein B2 OS=Mus musculus OX=10090 GN=Hmgb2 PE=1 SV=3
9	F1NPU8	2.08e-119	339	207	0.833	0.841	F1NPU8_CHICK High mobility group box 2 OS=Gallus gallus OX=9031 GN=HMGB2 PE=1 SV=1
10	P26584	1.34e-118	337	207	0.828	0.836	HMGB2_CHICK High mobility group protein B2 OS=Gallus gallus OX=9031 GN=HMGB2 PE=2 SV=2
11	F2Z594	1.15e-100	292	220	0.718	0.682	F2Z594_PIG High mobility group protein B1 OS=Sus scrofa OX=9823 GN=HMGB1 PE=1 SV=3
12	P09429	2.90e-100	291	215	0.718	0.698	HMGB1_HUMAN High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3
13	P10103	2.90e-100	291	215	0.718	0.698	HMGB1_BOVIN High mobility group protein B1 OS=Bos taurus OX=9913 GN=HMGB1 PE=1 SV=3
14	P63158	2.90e-100	291	215	0.718	0.698	HMGB1_MOUSE High mobility group protein B1 OS=Mus musculus OX=10090 GN=Hmgb1 PE=1 SV=2
15	P63159	2.90e-100	291	215	0.718	0.698	HMGB1_RAT High mobility group protein B1 OS=Rattus norvegicus OX=10116 GN=Hmgb1 PE=1 SV=2
16	P12682	2.30e-99	288	215	0.713	0.693	HMGB1_PIG High mobility group protein B1 OS=Sus scrofa OX=9823 GN=HMGB1 PE=1 SV=3
17	Q9YH06	3.37e-99	288	215	0.713	0.693	HMGB1_CHICK High mobility group protein B1 OS=Gallus gallus OX=9031 GN=HMGB1 PE=1 SV=1
18	X2JGB1	1.03e-92	271	212	0.679	0.670	X2JGB1_CYNSE Putative high mobility group B2 protein OS=Cynoglossus semilaevis OX=244447 GN=HMGB2 PE=2 SV=1
19	Q6NX86	1.03e-91	269	205	0.675	0.688	Q6NX86_DANRE High mobility group box 1a OS=Danio rerio OX=7955 GN=HMGB1 PE=1 SV=1
20	P07746	1.50e-88	261	204	0.603	0.618	HMGT_ONCMY High mobility group-T protein OS=Oncorhynchus mykiss OX=8022 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00178 Ets	38	16.0	Ets-domain
2	PF00505 HMG_box	7.3e-40	146.6	HMG (high mobility group) box
3	PF09011 HMG_box_2	8.6e-41	149.7	HMG-box domain
4	PF14887 HMG_box_5	80	14.6	HMG (high mobility group) box 5

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 89462.XP_006063814.1

Rank	PPI partner	STRING score	Description
1	89462.XP_006062933.1	0.921	Cellular tumor antigen p53
2	89462.XP_006059236.1	0.876	Advanced glycosylation end product-specific receptor isoform X1
3	89462.XP_006057275.1	0.852	Toll-like receptor 4 isoform X1
4	89462.XP_006042699.1	0.813	Protein disulfide-isomerase A3
5	89462.XP_006054263.1	0.813	Lymphocyte antigen 96 isoform X1
6	89462.XP_006056607.1	0.761	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
7	89462.XP_006066309.1	0.729	DNA helicase INO80 isoform X1
8	89462.XP_006053138.1	0.709	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
9	89462.XP_006039966.1	0.701	Toll-like receptor 2-like
10	89462.XP_006070177.1	0.701	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 28 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns
11	89462.XP_006078905.1	0.694	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 13 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
12	89462.XP_006047095.1	0.693	Protein S100-B
13	89462.XP_006045703.1	0.688	Histone H1.5-like
14	89462.XP_006044684.1	0.674	ruvB-like 2
15	89462.XP_006065972.1	0.668	Actin-related protein 5
16	89462.XP_006062157.1	0.665	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 29 samples with support for all annotated introns
17	89462.XP_006077075.1	0.658	Myeloid differentiation primary response protein MyD88 isoform X1
18	89462.XP_006071440.1	0.653	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
19	89462.XP_006044087.1	0.650	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
20	89462.XP_006063552.1	0.642	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 4 Proteins, and 89% coverage of the annotated genomic feature by RNAseq alignments

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008301	0.999	DNA binding, bending
GO:0005515	0.994	protein binding
GO:0003690	0.978	double-stranded DNA binding
GO:0043565	0.601	sequence-specific DNA binding
GO:1990837	0.503	sequence-specific double-stranded DNA binding
GO:0003697	0.471	single-stranded DNA binding
GO:0000976	0.453	transcription cis-regulatory region binding
GO:0008134	0.380	transcription factor binding
GO:0140110	0.317	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0071840	0.973	cellular component organization or biogenesis
GO:0050789	0.973	regulation of biological process
GO:0050794	0.961	regulation of cellular process
GO:0050896	0.947	response to stimulus
GO:0016043	0.939	cellular component organization
GO:0048518	0.927	positive regulation of biological process
GO:0019222	0.888	regulation of metabolic process
GO:0006950	0.883	response to stress
GO:0060255	0.872	regulation of macromolecule metabolic process
GO:0044238	0.828	primary metabolic process
GO:0071704	0.823	organic substance metabolic process
GO:0051276	0.787	chromosome organization
GO:0006807	0.784	nitrogen compound metabolic process
GO:0048522	0.732	positive regulation of cellular process
GO:0043170	0.653	macromolecule metabolic process
GO:0071103	0.646	DNA conformation change
GO:0044237	0.633	cellular metabolic process
GO:0080090	0.614	regulation of primary metabolic process
GO:0051171	0.614	regulation of nitrogen compound metabolic process
GO:0010604	0.598	positive regulation of macromolecule metabolic process
GO:0031323	0.589	regulation of cellular metabolic process
GO:0019219	0.479	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.474	regulation of gene expression
GO:0034641	0.470	cellular nitrogen compound metabolic process
GO:1901360	0.467	organic cyclic compound metabolic process
GO:0031325	0.459	positive regulation of cellular metabolic process
GO:0051173	0.458	positive regulation of nitrogen compound metabolic process
GO:0010556	0.455	regulation of macromolecule biosynthetic process
GO:0031326	0.454	regulation of cellular biosynthetic process
GO:0046483	0.448	heterocycle metabolic process
GO:0006725	0.448	cellular aromatic compound metabolic process
GO:0051252	0.444	regulation of RNA metabolic process
GO:0051716	0.443	cellular response to stimulus
GO:0006139	0.442	nucleobase-containing compound metabolic process
GO:0048519	0.416	negative regulation of biological process
GO:2001141	0.404	regulation of RNA biosynthetic process
GO:0090304	0.386	nucleic acid metabolic process
GO:0048523	0.379	negative regulation of cellular process
GO:0006355	0.337	regulation of DNA-templated transcription
GO:0006259	0.306	DNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005694	0.995	chromosome
GO:0005737	0.990	cytoplasm
GO:0005634	0.989	nucleus
GO:0043233	0.963	organelle lumen
GO:0031981	0.949	nuclear lumen
GO:0000785	0.926	chromatin
GO:0005654	0.880	nucleoplasm
GO:0032991	0.624	protein-containing complex
GO:0005576	0.465	extracellular region
GO:0005615	0.384	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]