StarFunc result for job id P26599

User Input

>input (531 residues)
MDGIVPDIAVGTKRGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRV
IHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPV
LRGQPIYIQFSNHKELKTDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQ
SPVLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLS
LDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGLS
VPNVHGALAPLAIPSAAAAAAAAGRIAIPGLAGAGNSVLLVSNLNPERVTPQSLFILFGV
YGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPREG
QEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGV
VKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P26599	1.000	1.000	1.833E-99	531	1.000	1.000	P26599.pdb.gz	PTBP1_HUMAN Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=2
2	AFDB:Q503D3	0.594	0.558	1.130E-81	574	0.787	0.728	Q503D3.pdb.gz	Q503D3_DANRE Polypyrimidine tract-binding protein 1 OS=Danio rerio OX=7955 GN=ptbp1 PE=1 SV=1
3	AFDB:Q66H20	0.459	0.459	1.541E-80	531	0.751	0.751	Q66H20.pdb.gz	PTBP2_RAT Polypyrimidine tract-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ptbp2 PE=1 SV=1
4	AFDB:O95758	0.681	0.659	4.950E-80	552	0.774	0.745	O95758.pdb.gz	PTBP3_HUMAN Polypyrimidine tract-binding protein 3 OS=Homo sapiens OX=9606 GN=PTBP3 PE=1 SV=2
5	AFDB:Q80XZ1	0.399	0.362	2.462E-67	588	0.653	0.590	Q80XZ1.pdb.gz	Q80XZ1_RAT Polypyrimidine tract-binding protein OS=Rattus norvegicus OX=10116 GN=Smptb PE=1 SV=1
6	AFDB:A0A0B4K6P4	0.371	0.248	2.367E-63	799	0.576	0.383	A0A0B4K6P4.pdb.gz	A0A0B4K6P4_DROME Hephaestus, isoform W OS=Drosophila melanogaster OX=7227 GN=heph PE=1 SV=1
7	AFDB:A0A0B4K6W9	0.409	0.254	4.362E-63	898	0.576	0.341	A0A0B4K6W9.pdb.gz	A0A0B4K6W9_DROME Hephaestus, isoform Y OS=Drosophila melanogaster OX=7227 GN=heph PE=1 SV=1
8	AFDB:Q6ICX4	0.347	0.424	1.425E-44	432	0.305	0.375	Q6ICX4.pdb.gz	PTBP3_ARATH Polypyrimidine tract-binding protein homolog 3 OS=Arabidopsis thaliana OX=3702 GN=At1g43190 PE=2 SV=1
9	AFDB:Q921F4	0.412	0.376	5.497E-40	591	0.269	0.242	Q921F4.pdb.gz	HNRLL_MOUSE Heterogeneous nuclear ribonucleoprotein L-like OS=Mus musculus OX=10090 GN=Hnrnpll PE=1 SV=3
10	AFDB:P14866	0.341	0.309	6.494E-40	589	0.266	0.239	P14866.pdb.gz	HNRPL_HUMAN Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2
11	PDB:5vsuA	0.136	0.182	7.036E-13	387	0.104	0.142	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
12	PDB:6r5kH	0.157	0.198	2.779E-9	394	0.124	0.168	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
13	PDB:6ff7X	0.134	0.390	2.243E-7	171	0.062	0.193	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
14	PDB:7oqcF	0.143	0.274	2.962E-7	267	0.075	0.150	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
15	PDB:7evoD	0.128	0.301	1.569E-6	200	0.066	0.175	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
16	PDB:6y5qq	0.135	0.380	1.854E-6	178	0.060	0.180	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
17	PDB:5lsbA	0.134	0.384	5.042E-6	176	0.058	0.176	5lsbA.pdb.gz
18	PDB:6y53o	0.134	0.431	5.957E-6	160	0.070	0.231	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
19	PDB:6exnY	0.145	0.805	2.527E-5	87	0.056	0.345	6exnY.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
20	PDB:6gd1A	0.136	0.368	6.501E-5	190	0.043	0.121	6gd1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4K6P4	556	799	0.589	0.392	A0A0B4K6P4_DROME Hephaestus, isoform W OS=Drosophila melanogaster OX=7227 GN=heph PE=1 SV=1
2	A0A0B4K6W9	556	898	0.589	0.349	A0A0B4K6W9_DROME Hephaestus, isoform Y OS=Drosophila melanogaster OX=7227 GN=heph PE=1 SV=1
3	A0A0B4LHY1	561	604	0.593	0.522	A0A0B4LHY1_DROME Hephaestus, isoform Z OS=Drosophila melanogaster OX=7227 GN=heph PE=1 SV=1
4	A8JRI1	551	622	0.591	0.505	A8JRI1_DROME Hephaestus, isoform L OS=Drosophila melanogaster OX=7227 GN=heph PE=1 SV=1
5	O95758	797	552	0.776	0.746	PTBP3_HUMAN Polypyrimidine tract-binding protein 3 OS=Homo sapiens OX=9606 GN=PTBP3 PE=1 SV=2
6	P17225	1034	555	0.970	0.928	PTBP1_MOUSE Polypyrimidine tract-binding protein 1 OS=Mus musculus OX=10090 GN=Ptbp1 PE=1 SV=3
7	P26599	1071	557	1.000	0.953	PTBP1_HUMAN Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=2
8	Q00438	1038	556	0.970	0.926	PTBP1_RAT Polypyrimidine tract-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ptbp1 PE=1 SV=2
9	Q503D3	836	574	0.797	0.737	Q503D3_DANRE Polypyrimidine tract-binding protein 1 OS=Danio rerio OX=7955 GN=ptbp1 PE=1 SV=1
10	Q66H20	798	531	0.755	0.755	PTBP2_RAT Polypyrimidine tract-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ptbp2 PE=1 SV=1
11	Q7KES3	543	568	0.559	0.523	Q7KES3_DROME Hephaestus OS=Drosophila melanogaster OX=7227 GN=heph PE=1 SV=1
12	Q7KRS7	557	615	0.595	0.514	Q7KRS7_DROME Hephaestus, isoform G OS=Drosophila melanogaster OX=7227 GN=heph PE=1 SV=1
13	Q80XZ1	659	588	0.652	0.588	Q80XZ1_RAT Polypyrimidine tract-binding protein OS=Rattus norvegicus OX=10116 GN=Smptb PE=1 SV=1
14	Q8BHD7	761	523	0.734	0.746	PTBP3_MOUSE Polypyrimidine tract-binding protein 3 OS=Mus musculus OX=10090 GN=Ptbp3 PE=1 SV=1
15	Q8IMF8	551	581	0.591	0.540	Q8IMF8_DROME Hephaestus, isoform C OS=Drosophila melanogaster OX=7227 GN=heph PE=1 SV=1
16	Q8WR53	557	608	0.595	0.520	Q8WR53_DROME Hephaestus, isoform B OS=Drosophila melanogaster OX=7227 GN=heph PE=1 SV=1
17	Q91Z31	798	531	0.755	0.755	PTBP2_MOUSE Polypyrimidine tract-binding protein 2 OS=Mus musculus OX=10090 GN=Ptbp2 PE=1 SV=2
18	Q95UI6	552	789	0.591	0.398	Q95UI6_DROME Hephaestus OS=Drosophila melanogaster OX=7227 GN=heph PE=1 SV=1
19	Q9UKA9	796	531	0.757	0.757	PTBP2_HUMAN Polypyrimidine tract-binding protein 2 OS=Homo sapiens OX=9606 GN=PTBP2 PE=1 SV=1
20	Q9Z118	755	523	0.736	0.748	PTBP3_RAT Polypyrimidine tract-binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ptbp3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	4.2e-33	124.3	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
2	PF13893 RRM_5	7.6e-63	221.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF11835 RRM_8	1.3e-11	55.8	RRM-like domain
4	PF16842 RRM_occluded	6.6e-09	46.9	Occluded RNA-recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349428

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221419	0.999	Heterogeneous nuclear ribonucleoprotein L
2	9606.ENSP00000341826	0.999	Heterogeneous nuclear ribonucleoprotein A1
3	9606.ENSP00000346694	0.999	Heterogeneous nuclear ribonucleoproteins A2/B1
4	9606.ENSP00000365439	0.999	Heterogeneous nuclear ribonucleoprotein K
5	9606.ENSP00000349168	0.997	Heterogeneous nuclear ribonucleoprotein H
6	9606.ENSP00000451291	0.997	Heterogeneous nuclear ribonucleoproteins C1/C2
7	9606.ENSP00000385269	0.996	ELAV-like protein 1
8	9606.ENSP00000325376	0.995	Heterogeneous nuclear ribonucleoprotein M
9	9606.ENSP00000316042	0.994	Heterogeneous nuclear ribonucleoprotein A0
10	9606.ENSP00000400433	0.994	Heterogeneous nuclear ribonucleoprotein F
11	9606.ENSP00000363745	0.993	Heterogeneous nuclear ribonucleoprotein R
12	9606.ENSP00000359645	0.992	RNA-binding motif protein, X chromosome
13	9606.ENSP00000305556	0.990	Poly(rC)-binding protein 1
14	9606.ENSP00000313199	0.990	Heterogeneous nuclear ribonucleoprotein D0
15	9606.ENSP00000349748	0.990	Splicing factor, proline- and glutamine-rich
16	9606.ENSP00000376309	0.986	Heterogeneous nuclear ribonucleoprotein A3
17	9606.ENSP00000258962	0.984	Serine/arginine-rich splicing factor 1
18	9606.ENSP00000352438	0.983	Poly(rC)-binding protein 2
19	9606.ENSP00000354346	0.983	Matrin-3
20	9606.ENSP00000307863	0.981	Splicing factor U2AF 65 kDa subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.999	protein binding
GO:0003729	0.959	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050794	0.992	regulation of cellular process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0080090	0.975	regulation of primary metabolic process
GO:0051171	0.975	regulation of nitrogen compound metabolic process
GO:0009987	0.970	cellular process
GO:0010468	0.970	regulation of gene expression
GO:0031323	0.967	regulation of cellular metabolic process
GO:0019219	0.931	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.913	regulation of RNA metabolic process
GO:0010605	0.902	negative regulation of macromolecule metabolic process
GO:0051172	0.894	negative regulation of nitrogen compound metabolic process
GO:0031324	0.890	negative regulation of cellular metabolic process
GO:0071704	0.868	organic substance metabolic process
GO:0010629	0.822	negative regulation of gene expression
GO:0044237	0.821	cellular metabolic process
GO:0044238	0.820	primary metabolic process
GO:0043170	0.814	macromolecule metabolic process
GO:0043484	0.807	regulation of RNA splicing
GO:0006807	0.804	nitrogen compound metabolic process
GO:0045934	0.725	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.712	negative regulation of RNA metabolic process
GO:0034641	0.620	cellular nitrogen compound metabolic process
GO:0033119	0.573	negative regulation of RNA splicing
GO:0010467	0.566	gene expression
GO:0046483	0.545	heterocycle metabolic process
GO:1901360	0.544	organic cyclic compound metabolic process
GO:0006725	0.515	cellular aromatic compound metabolic process
GO:0006139	0.512	nucleobase-containing compound metabolic process
GO:0090304	0.493	nucleic acid metabolic process
GO:0016070	0.424	RNA metabolic process
GO:0006396	0.410	RNA processing
GO:0048518	0.382	positive regulation of biological process
GO:1903311	0.342	regulation of mRNA metabolic process
GO:0048522	0.317	positive regulation of cellular process
GO:0008380	0.315	RNA splicing
GO:0016071	0.300	mRNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0032991	0.969	protein-containing complex
GO:0005654	0.949	nucleoplasm
GO:0005737	0.838	cytoplasm
GO:0005829	0.816	cytosol
GO:1990904	0.519	ribonucleoprotein complex
GO:0140513	0.303	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]