StarFunc result for job id P26639

User Input

>input (723 residues)
MFEEKASSPSGKMGGEEKPIGAGEEKQKEGGKKKNKEGSGDGGRAELNPWPEYIYTRLEM
YNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIA
KVNNVVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIE
NGFYYDMYLEEGGVSSNDFSSLEALCKKIIKEKQAFERLEVKKETLLAMFKYNKFKCRIL
NEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSTYWEGKADMETLQRIYGI
SFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNALIEFI
RSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMF
DHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCL
DFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFY
GPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERM
IAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNK
KIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRSKQAE
EEF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QF48	0.869	0.896	0.000	701	0.763	0.787	A0A2R8QF48.pdb.gz
2	AFDB:A2BIM7	0.947	0.954	0.000	718	0.840	0.845	A2BIM7.pdb.gz
3	AFDB:A2RTX5	0.933	0.842	0.000	802	0.710	0.640	A2RTX5.pdb.gz	SYTC2_HUMAN Threonine--tRNA ligase 2, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS3 PE=1 SV=1
4	AFDB:P26639	1.000	1.000	0.000	723	1.000	1.000	P26639.pdb.gz	SYTC_HUMAN Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3
5	AFDB:P52709	0.905	0.903	0.000	725	0.588	0.586	P52709.pdb.gz	SYTC_CAEEL Threonine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=tars-1 PE=3 SV=1
6	AFDB:Q5XIZ3	0.434	0.503	0.000	624	0.719	0.833	Q5XIZ3.pdb.gz	Q5XIZ3_DANRE threonine--tRNA ligase OS=Danio rerio OX=7955 GN=zgc:92586 PE=1 SV=1
7	AFDB:Q8BLY2	0.918	0.841	0.000	790	0.697	0.638	Q8BLY2.pdb.gz	SYTC2_MOUSE Threonine--tRNA ligase 2, cytoplasmic OS=Mus musculus OX=10090 GN=Tars3 PE=1 SV=1
8	AFDB:Q8MRL7	0.927	0.897	0.000	747	0.698	0.676	Q8MRL7.pdb.gz	Q8MRL7_DROME threonine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ThrRS PE=2 SV=1
9	AFDB:Q54J66	0.903	0.919	3.044E-103	710	0.562	0.572	Q54J66.pdb.gz	SYTC1_DICDI Probable threonine--tRNA ligase 1, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=thrS1 PE=3 SV=1
10	AFDB:Q3UQ84	0.889	0.889	2.017E-102	723	0.520	0.520	Q3UQ84.pdb.gz	SYTM_MOUSE Threonine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Tars2 PE=1 SV=1
11	PDB:1qf6A	0.775	0.866	4.555E-75	641	0.344	0.388	1qf6A.pdb.gz	The structure of threonyl-tRNA synthetase-tRNA(Thr) complex enlightens its repressor activity and reveals an essential zinc ion in the active site
12	PDB:3ugtC	0.507	0.841	4.555E-44	427	0.256	0.433	3ugtC.pdb.gz	Yeast mitochondrial threonyl-tRNA synthetase recognizes tRNA isoacceptors by distinct mechanisms and promotes CUN codon reassignment.
13	PDB:1nj1A	0.436	0.659	4.684E-22	463	0.095	0.149	1nj1A.pdb.gz	The structural basis of cysteine aminoacylation of tRNAPro by prolyl-tRNA synthetases
14	PDB:5e6mB	0.422	0.588	1.347E-17	506	0.097	0.138	5e6mB.pdb.gz	Crystal Structure of the Wild-Type Human GlyRS Bound with tRNA(Gly) in a Productive Conformation
15	PDB:1httA	0.365	0.640	4.422E-17	366	0.084	0.167	1httA.pdb.gz	Crystal structure of histidyl-tRNA synthetase from Escherichia coli complexed with histidyl-adenylate.
16	PDB:1kmmC	0.359	0.604	1.170E-16	387	0.083	0.155	1kmmC.pdb.gz	The first step of aminoacylation at the atomic level in histidyl-tRNA synthetase.
17	PDB:5e6mA	0.416	0.565	2.492E-16	519	0.089	0.123	5e6mA.pdb.gz	Crystal Structure of the Wild-Type Human GlyRS Bound with tRNA(Gly) in a Productive Conformation
18	PDB:3j7y7	0.298	0.758	2.630E-16	266	0.083	0.226	3j7y7.pdb.gz	Structure of the large ribosomal subunit from human mitochondria.
19	PDB:1atiA	0.413	0.662	4.278E-16	437	0.097	0.160	1atiA.pdb.gz	Crystal structure of glycyl-tRNA synthetase from Thermus thermophilus.
20	PDB:3hriF	0.343	0.601	5.310E-16	370	0.097	0.189	3hriF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A2RTX5	1098	802	0.701	0.632	SYTC2_HUMAN Threonine--tRNA ligase 2, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS3 PE=1 SV=1
2	A8KC60	1285	718	0.828	0.834	A8KC60_DANRE threonine--tRNA ligase OS=Danio rerio OX=7955 GN=wu:fb39c12 PE=1 SV=1
3	B2RDX5	1482	711	0.981	0.997	B2RDX5_HUMAN threonine--tRNA ligase OS=Homo sapiens OX=9606 PE=1 SV=1
4	O04630	772	709	0.505	0.515	SYTM1_ARATH Threonine--tRNA ligase, mitochondrial 1 OS=Arabidopsis thaliana OX=3702 GN=THRRS PE=1 SV=3
5	P04801	811	734	0.542	0.534	SYTC_YEAST Threonine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=THS1 PE=1 SV=2
6	P26639	1511	723	1.000	1.000	SYTC_HUMAN Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3
7	P52709	925	725	0.591	0.589	SYTC_CAEEL Threonine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=tars-1 PE=3 SV=1
8	P87144	809	703	0.534	0.549	SYTC_SCHPO Threonine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ths1 PE=3 SV=1
9	Q3UQ84	805	723	0.521	0.521	SYTM_MOUSE Threonine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Tars2 PE=1 SV=1
10	Q53GX7	1509	723	0.999	0.999	Q53GX7_HUMAN threonine--tRNA ligase (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
11	Q54J66	836	710	0.553	0.563	SYTC1_DICDI Probable threonine--tRNA ligase 1, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=thrS1 PE=3 SV=1
12	Q57W54	703	799	0.516	0.467	Q57W54_TRYB2 threonine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.150 PE=3 SV=1
13	Q5XIZ3	610	624	0.389	0.450	Q5XIZ3_DANRE threonine--tRNA ligase OS=Danio rerio OX=7955 GN=zgc:92586 PE=1 SV=1
14	Q86D21	926	684	0.591	0.624	Q86D21_CAEEL threonine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=tars-1 PE=1 SV=1
15	Q8BLY2	1101	790	0.711	0.651	SYTC2_MOUSE Threonine--tRNA ligase 2, cytoplasmic OS=Mus musculus OX=10090 GN=Tars3 PE=1 SV=1
16	Q8IGC5	1077	711	0.700	0.712	Q8IGC5_DROME threonine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ThrRS PE=2 SV=1
17	Q8IIA4	546	1013	0.336	0.240	Q8IIA4_PLAF7 threonine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1126000 PE=3 SV=1
18	Q8IP94	1082	690	0.701	0.735	Q8IP94_DROME threonine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ThrRS PE=1 SV=1
19	Q8MRL7	1075	747	0.698	0.676	Q8MRL7_DROME threonine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ThrRS PE=2 SV=1
20	Q9BW92	782	718	0.517	0.521	SYTM_HUMAN Threonine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=TARS2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03129 HGTP_anticodon	7.7e-17	72.6	Anticodon binding domain
2	PF02824 TGS	1.3e-13	62.1	TGS domain
3	PF00587 tRNA-synt_2b	3.4e-33	126.6	tRNA synthetase class II core domain (G, H, P, S and T)
4	PF07973 tRNA_SAD	4.7e-09	47.5	Threonyl and Alanyl tRNA synthetase second additional domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003818554.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003807230.1	0.944	glutamyl-prolyl-tRNA synthetase
2	9597.XP_008958682.1	0.930	seryl-tRNA synthetase
3	9597.XP_003833426.1	0.926	glycyl-tRNA synthetase
4	9597.XP_003827295.1	0.922	asparaginyl-tRNA synthetase
5	9597.XP_003807881.1	0.919	isoleucyl-tRNA synthetase
6	9597.XP_008976744.1	0.903	Belongs to the class-I aminoacyl-tRNA synthetase family.
7	9597.XP_003829595.1	0.890	lysyl-tRNA synthetase
8	9597.XP_008952078.1	0.890	threonyl-tRNA synthetase like 2
9	9597.XP_003829131.1	0.887	Belongs to the class-I aminoacyl-tRNA synthetase family.
10	9597.XP_003818721.1	0.869	phenylalanine--tRNA ligase beta subunit
11	9597.XP_008963768.1	0.865	tyrosine--tRNA ligase, cytoplasmic-like
12	9597.XP_003833266.1	0.857	Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain.
13	9597.XP_003829211.1	0.853	histidyl-tRNA synthetase
14	9597.XP_003811107.1	0.851	Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain.
15	9597.XP_003820699.1	0.849	Mitochondrial ribosomal protein L50
16	9597.XP_003812580.1	0.840	tyrosine--tRNA ligase, cytoplasmic
17	9597.XP_003832329.1	0.831	Mitochondrial ribosomal protein L1
18	9597.XP_008957696.1	0.827	Belongs to the class-I aminoacyl-tRNA synthetase family.
19	9597.XP_003817351.1	0.820	threonyl-tRNA synthetase 2, mitochondrial (putative)
20	9597.XP_008955135.1	0.815	valyl-tRNA synthetase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0004812	0.865	aminoacyl-tRNA ligase activity
GO:0004829	0.739	threonine-tRNA ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.980	organic substance metabolic process
GO:0044238	0.975	primary metabolic process
GO:0006807	0.975	nitrogen compound metabolic process
GO:0044237	0.973	cellular metabolic process
GO:1901564	0.965	organonitrogen compound metabolic process
GO:0043170	0.959	macromolecule metabolic process
GO:0006518	0.958	peptide metabolic process
GO:0043039	0.948	tRNA aminoacylation
GO:0006412	0.940	translation
GO:0006418	0.923	tRNA aminoacylation for protein translation
GO:0065007	0.540	biological regulation
GO:0050789	0.525	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043227	0.987	membrane-bounded organelle
GO:0005829	0.907	cytosol
GO:0005576	0.871	extracellular region
GO:1903561	0.849	extracellular vesicle
GO:0070062	0.840	extracellular exosome
GO:0043231	0.837	intracellular membrane-bounded organelle
GO:0043233	0.545	organelle lumen
GO:0070013	0.519	intracellular organelle lumen
GO:0032991	0.452	protein-containing complex
GO:0005739	0.318	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.1.1.-	0.865	Ligases forming aminoacyl-tRNA and related compounds.
RHEA:24624	0.739	ATP + L-threonine + tRNA(Thr) = AMP + diphosphate + H(+) + L-threonyl-tRNA(Thr)
EC:6.1.1.3	0.739	threonine--tRNA ligase.

[back to server]