StarFunc result for job id P26640

User Input

>input (1264 residues)
MSTLYVSPHPDAFPSLRALIAARYGEAGEGPGWGGAHPRICLQPPPTSRTPFPPPRLPAL
EQGPGGLWVWGATAVAQLLWPAGLGGPGGSRAAVLVQQWVSYADTELIPAACGATLPALG
LRSSAQDPQAVLGALGRALSPLEEWLRLHTYLAGEAPTLADLAAVTALLLPFRYVLDPPA
RRIWNNVTRWFVTCVRQPEFRAVLGEVVLYSGARPLSHQPGPEAPALPKTAAQLKKEAKK
REKLEKFQQKQKIQQQQPPPGEKKPKPEKREKRDPGVITYDLPTPPGEKKDVSGPMPDSY
SPRYVEAAWYPWWEQQGFFKPEYGRPNVSAANPRGVFMMCIPPPNVTGSLHLGHALTNAI
QDSLTRWHRMRGETTLWNPGCDHAGIATQVVVEKKLWREQGLSRHQLGREAFLQEVWKWK
EEKGDRIYHQLKKLGSSLDWDRACFTMDPKLSAAVTEAFVRLHEEGIIYRSTRLVNWSCT
LNSAISDIEVDKKELTGRTLLSVPGYKEKVEFGVLVSFAYKVQGSDSDEEVVVATTRIET
MLGDVAVAVHPKDTRYQHLKGKNVIHPFLSRSLPIVFDEFVDMDFGTGAVKITPAHDQND
YEVGQRHGLEAISIMDSRGALINVPPPFLGLPRFEARKAVLVALKERGLFRGIEDNPMVV
PLCNRSKDVVEPLLRPQWYVRCGEMAQAASAAVTRGDLRILPEAHQRTWHAWMDNIREWC
ISRQLWWGHRIPAYFVTVSDPAVPPGEDPDGRYWVSGRNEAEAREKAAKEFGVSPDKISL
QQDEDVLDTWFSSGLFPLSILGWPNQSEDLSVFYPGTLLETGHDILFFWVARMVMLGLKL
TGRLPFREVYLHAIVRDAHGRKMSKSLGNVIDPLDVIYGISLQGLHNQLLNSNLDPSEVE
KAKEGQKADFPAGIPECGTDALRFGLCAYMSQGRDINLDVNRILGYRHFCNKLWNATKFA
LRGLGKGFVPSPTSQPGGHESLVDRWIRSRLTEAVRLSNQGFQAYDFPAVTTAQYSFWLY
ELCDVYLECLKPVLNGVDQVAAECARQTLYTCLDVGLRLLSPFMPFVTEELFQRLPRRMP
QAPPSLCVTPYPEPSECSWKDPEAEAALELALSITRAVRSLRADYNLTRIRPDCFLEVAD
EATGALASAVSGYVQALASAGVVAVLALGAPAPQGCAVALASDRCSIHLQLQGLVDPARE
LGKLQAKRVEAQRQAQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALF
QKML

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RCN6	0.808	0.808	0.000	1264	1.000	1.000	A0A024RCN6.pdb.gz	A0A024RCN6_HUMAN Valine--tRNA ligase OS=Homo sapiens OX=9606 PE=1 SV=1
2	AFDB:A0A0B4KF06	0.770	0.919	0.000	1055	0.493	0.591	A0A0B4KF06.pdb.gz	A0A0B4KF06_DROME Valine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ValRS PE=1 SV=1
3	AFDB:Q9U1Q4	0.778	0.932	0.000	1050	0.440	0.530	Q9U1Q4.pdb.gz	SYV_CAEEL Valine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=glp-4 PE=1 SV=1
4	AFDB:Q86KU2	0.742	0.871	2.451E-102	1072	0.407	0.479	Q86KU2.pdb.gz	SYVC_DICDI Probable valine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=valS1 PE=3 SV=1
5	AFDB:Q3U2A8	0.734	0.873	3.036E-102	1060	0.420	0.501	Q3U2A8.pdb.gz	SYVM_MOUSE Valine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Vars2 PE=1 SV=2
6	AFDB:Q5ST30	0.742	0.879	5.533E-102	1063	0.410	0.487	Q5ST30.pdb.gz	SYVM_HUMAN Valine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=VARS2 PE=1 SV=2
7	AFDB:Q6FTE7	0.748	0.852	1.566E-100	1105	0.409	0.468	Q6FTE7.pdb.gz	Q6FTE7_CANGA valine--tRNA ligase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0G03091g PE=3 SV=1
8	AFDB:P93736	0.713	0.809	3.691E-100	1108	0.387	0.441	P93736.pdb.gz	SYVM1_ARATH Valine--tRNA ligase, mitochondrial 1 OS=Arabidopsis thaliana OX=3702 GN=TWN2 PE=1 SV=2
9	AFDB:P07806	0.744	0.849	1.881E-99	1104	0.407	0.466	P07806.pdb.gz	SYV_YEAST Valine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAS1 PE=1 SV=2
10	AFDB:Q587B4	0.738	0.952	3.708E-96	975	0.363	0.471	Q587B4.pdb.gz	Q587B4_TRYB2 valine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.740 PE=3 SV=1
11	PDB:7d5cA	0.541	0.725	4.691E-37	919	0.164	0.225	7d5cA.pdb.gz	Inhibitory mechanism of reveromycin A at the tRNA binding site of a class I synthetase.
12	PDB:3zgzD	0.344	0.489	1.356E-26	867	0.125	0.182	3zgzD.pdb.gz	Plant Tumour Biocontrol Agent Employs a tRNA-Dependent Mechanism to Inhibit Leucyl-tRNA Synthetase
13	PDB:4ariA	0.336	0.503	2.844E-25	821	0.129	0.199	4ariA.pdb.gz	Structural Dynamics of the Aminoacylation and Proofreading Functional Cycle of Bacterial Leucyl-tRNA Synthetase
14	PDB:6lpfB	0.389	0.480	9.376E-22	1006	0.119	0.150	6lpfB.pdb.gz	Molecular basis of the multifaceted functions of human leucyl-tRNA synthetase in protein synthesis and beyond.
15	PDB:6ax8A	0.329	0.773	1.583E-13	509	0.080	0.198	6ax8A.pdb.gz	The crystal structure of the drug target Mycobacterium tuberculosis methionyl-tRNA synthetase in complex with a catalytic intermediate.
16	PDB:1aw9A	0.133	0.678	1.531E-5	216	0.037	0.218	1aw9A.pdb.gz
17	PDB:1byeA	0.133	0.694	6.033E-5	213	0.035	0.207	1byeA.pdb.gz	Structures of herbicides in complex with their detoxifying enzyme glutathione S-transferase - explanations for the selectivity of the enzyme in plants.
18	PDB:1u0bB	0.212	0.516	1.009E-4	461	0.074	0.204	1u0bB.pdb.gz	Shape-selective RNA recognition by cysteinyl-tRNA synthetase
19	PDB:2c3qA	0.134	0.608	1.549E-4	239	0.036	0.192	2c3qA.pdb.gz	Structural Basis of the Suppressed Catalytic Activity of Wild-Type Human Glutathione Transferase T1-1 Compared to its W234R Mutant.
20	PDB:3gh6A	0.133	0.701	1.617E-4	209	0.030	0.182	3gh6A.pdb.gz	Structural evidence for conformational changes of Delta class glutathione transferases after ligand binding

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A024RCN6	2590	1264	1.000	1.000	A0A024RCN6_HUMAN Valine--tRNA ligase OS=Homo sapiens OX=9606 PE=1 SV=1
2	A0A0B4KF06	1297	1055	0.493	0.591	A0A0B4KF06_DROME Valine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ValRS PE=1 SV=1
3	F4KE63	628	974	0.296	0.384	SYVM2_ARATH Valine--tRNA ligase, chloroplastic/mitochondrial 2 OS=Arabidopsis thaliana OX=3702 GN=EMB2247 PE=3 SV=1
4	O75005	984	980	0.399	0.514	SYV_SCHPO Valine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vas2 PE=3 SV=1
5	P07118	692	951	0.309	0.411	SYV_ECOLI Valine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=valS PE=1 SV=2
6	P07806	986	1104	0.392	0.449	SYV_YEAST Valine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAS1 PE=1 SV=2
7	P26640	2590	1264	1.000	1.000	SYVC_HUMAN Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4
8	P93736	951	1108	0.377	0.430	SYVM1_ARATH Valine--tRNA ligase, mitochondrial 1 OS=Arabidopsis thaliana OX=3702 GN=TWN2 PE=1 SV=2
9	P9WFS9	585	886	0.300	0.428	SYV_MYCTU Valine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=valS PE=1 SV=2
10	Q04462	2365	1264	0.934	0.934	SYVC_RAT Valine--tRNA ligase OS=Rattus norvegicus OX=10116 GN=Vars1 PE=2 SV=2
11	Q0E993	1304	1049	0.493	0.594	Q0E993_DROME Valine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ValRS PE=1 SV=1
12	Q3U2A8	1018	1060	0.419	0.499	SYVM_MOUSE Valine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Vars2 PE=1 SV=2
13	Q587B4	903	975	0.366	0.475	Q587B4_TRYB2 valine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.740 PE=3 SV=1
14	Q5ST30	974	1063	0.412	0.490	SYVM_HUMAN Valine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=VARS2 PE=1 SV=2
15	Q6FTE7	1002	1105	0.389	0.445	Q6FTE7_CANGA valine--tRNA ligase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0G03091g PE=3 SV=1
16	Q72E47	619	884	0.291	0.416	SYV_DESVH Valine--tRNA ligase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=valS PE=1 SV=1
17	Q86KU2	1036	1072	0.398	0.469	SYVC_DICDI Probable valine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=valS1 PE=3 SV=1
18	Q960E6	1310	1049	0.494	0.595	Q960E6_DROME Valine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ValRS PE=2 SV=1
19	Q9U1Q4	1116	1050	0.429	0.516	SYV_CAEEL Valine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=glp-4 PE=1 SV=1
20	Q9VSR7	677	994	0.313	0.398	Q9VSR7_DROME valine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ValRS-m PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08264 Anticodon_1	3.4e-29	113.2	Anticodon-binding domain of tRNA ligase
2	PF00043 GST_C	2.2e-08	45.5	Glutathione S-transferase, C-terminal domain
3	PF13410 GST_C_2	52	15.2	Glutathione S-transferase, C-terminal domain
4	PF14804 Jag_N	2.8e+02	13.2	Jag N-terminus
5	PF00133 tRNA-synt_1	1.7e-196	665.8	tRNA synthetases class I (I, L, M and V)
6	PF01406 tRNA-synt_1e	2.2e+02	12.6	tRNA synthetases class I (C) catalytic domain
7	PF09334 tRNA-synt_1g	2.9e-07	41.2	tRNA synthetases class I (M)
8	PF13603 tRNA-synt_1_2	1.4e-06	39.4	Leucyl-tRNA synthetase, Domain 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364815

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355890	0.989	Bifunctional glutamate/proline--tRNA ligase
2	9606.ENSP00000377954	0.988	Leucine--tRNA ligase, cytoplasmic
3	9606.ENSP00000410059	0.975	Elongation factor 1-delta
4	9606.ENSP00000364794	0.964	Isoleucine--tRNA ligase, cytoplasmic
5	9606.ENSP00000376056	0.958	Elongation factor 1-beta
6	9606.ENSP00000364840	0.956	Von Willebrand factor A domain containing 7
7	9606.ENSP00000307567	0.949	Glutamine--tRNA ligase
8	9606.ENSP00000369897	0.936	Cysteine--tRNA ligase, cytoplasmic
9	9606.ENSP00000331901	0.927	Elongation factor 1-gamma
10	9606.ENSP00000339063	0.922	Elongation factor 1-alpha 1
11	9606.ENSP00000362576	0.919	Tyrosine--tRNA ligase, cytoplasmic
12	9606.ENSP00000373918	0.919	Glycine--tRNA ligase
13	9606.ENSP00000325448	0.913	Lysine--tRNA ligase
14	9606.ENSP00000320309	0.897	phenylalanyl-tRNA synthetase alpha subunit
15	9606.ENSP00000316335	0.880	Phenylalanine--tRNA ligase, mitochondrial
16	9606.ENSP00000264161	0.869	Aspartate--tRNA ligase, cytoplasmic
17	9606.ENSP00000261772	0.867	Alanine--tRNA ligase, cytoplasmic
18	9606.ENSP00000244571	0.859	Alanine--tRNA ligase, mitochondrial
19	9606.ENSP00000376946	0.845	Bardet-Biedl syndrome 10 protein
20	9606.ENSP00000387710	0.841	Threonine--tRNA ligase, cytoplasmic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004832	1.000	valine-tRNA ligase activity
GO:0005488	0.992	binding
GO:0005515	0.951	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.994	macromolecule metabolic process
GO:1901564	0.991	organonitrogen compound metabolic process
GO:0034641	0.988	cellular nitrogen compound metabolic process
GO:0009058	0.975	biosynthetic process
GO:1901576	0.974	organic substance biosynthetic process
GO:0044249	0.973	cellular biosynthetic process
GO:0019538	0.972	protein metabolic process
GO:0044260	0.965	cellular macromolecule metabolic process
GO:0006139	0.965	nucleobase-containing compound metabolic process
GO:0010467	0.961	gene expression
GO:1901566	0.959	organonitrogen compound biosynthetic process
GO:0044271	0.959	cellular nitrogen compound biosynthetic process
GO:0006418	0.936	tRNA aminoacylation for protein translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0043231	0.958	intracellular membrane-bounded organelle
GO:0005739	0.732	mitochondrion
GO:0043233	0.610	organelle lumen
GO:0070013	0.604	intracellular organelle lumen
GO:0032991	0.419	protein-containing complex
GO:0005634	0.356	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10704	1.000	ATP + L-valine + tRNA(Val) = AMP + diphosphate + L-valyl-tRNA(Val)
EC:6.1.1.9	1.000	valine--tRNA ligase.

[back to server]