StarFunc result for job id P26641

User Input

>input (437 residues)
MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPA
FEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGI
MHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSF
RQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREE
KQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNE
DTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASV
ILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWE
GAFQHVGKAFNQGKIFK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P26641	1.000	1.000	7.064E-81	437	1.000	1.000	P26641.pdb.gz	EF1G_HUMAN Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3
2	AFDB:Q9NJH0	0.825	0.835	6.479E-55	431	0.574	0.582	Q9NJH0.pdb.gz	EF1G_DROME Elongation factor 1-gamma OS=Drosophila melanogaster OX=7227 GN=eEF1gamma PE=2 SV=2
3	AFDB:B0G141	0.463	0.492	1.114E-40	410	0.430	0.459	B0G141.pdb.gz	B0G141_DICDI Glutathione S-transferase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=efa1G PE=4 SV=1
4	AFDB:O04487	0.604	0.630	3.045E-37	414	0.366	0.386	O04487.pdb.gz	EF1G1_ARATH Probable elongation factor 1-gamma 1 OS=Arabidopsis thaliana OX=3702 GN=At1g09640 PE=1 SV=1
5	AFDB:Q5AYR7	0.477	0.505	5.198E-37	411	0.334	0.355	Q5AYR7.pdb.gz	Q5AYR7_EMENI Elongation factor 1-gamma, putative (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06563 PE=4 SV=1
6	AFDB:Q9FVT2	0.567	0.592	1.159E-36	413	0.355	0.375	Q9FVT2.pdb.gz	EF1G2_ARATH Probable elongation factor 1-gamma 2 OS=Arabidopsis thaliana OX=3702 GN=At1g57720 PE=1 SV=1
7	AFDB:P36008	0.449	0.474	1.352E-34	412	0.320	0.340	P36008.pdb.gz	EF1G2_YEAST Elongation factor 1-gamma 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TEF4 PE=1 SV=1
8	AFDB:P29547	0.595	0.622	1.347E-33	415	0.320	0.337	P29547.pdb.gz	EF1G1_YEAST Elongation factor 1-gamma 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAM1 PE=1 SV=2
9	AFDB:P40921	0.450	0.479	2.180E-33	409	0.325	0.347	P40921.pdb.gz	EF1G_SCHPO Elongation factor 1-gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tef3 PE=1 SV=1
10	AFDB:Q4WR90	0.472	0.920	3.036E-20	220	0.195	0.386	Q4WR90.pdb.gz	Q4WR90_ASPFU Translation elongation factor eEF-1B gamma subunit, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_1G17120 PE=3 SV=1
11	PDB:1aw9A	0.409	0.785	1.151E-10	216	0.110	0.222	1aw9A.pdb.gz
12	PDB:1byeA	0.414	0.807	1.151E-10	213	0.117	0.239	1byeA.pdb.gz	Structures of herbicides in complex with their detoxifying enzyme glutathione S-transferase - explanations for the selectivity of the enzyme in plants.
13	PDB:5a4uA	0.406	0.800	2.306E-10	211	0.105	0.218	5a4uA.pdb.gz	Structural evidence for Arabidopsis glutathione transferase AtGSTF2 functioning as a transporter of small organic ligands.
14	PDB:3gh6A	0.368	0.733	4.153E-10	209	0.094	0.196	3gh6A.pdb.gz	Structural evidence for conformational changes of Delta class glutathione transferases after ligand binding
15	PDB:6ezyB	0.403	0.789	4.381E-10	212	0.101	0.208	6ezyB.pdb.gz	Redox-regulated methionine oxidation of Arabidopsis thaliana glutathione transferase Phi9 induces H-site flexibility.
16	PDB:3ergA	0.358	0.702	7.089E-10	208	0.098	0.207	3ergA.pdb.gz	Structures of yeast glutathione-S-transferase Gtt2 reveal a new catalytic type of GST family.
17	PDB:3makA	0.382	0.766	1.347E-9	208	0.089	0.188	3makA.pdb.gz	Structural evidence for conformational changes of Delta class glutathione transferases after ligand binding
18	PDB:5f0gA	0.377	0.764	1.856E-9	207	0.089	0.188	5f0gA.pdb.gz
19	PDB:5hfkA	0.393	0.780	2.425E-9	207	0.105	0.222	5hfkA.pdb.gz	Structure and function of YghU, a nu-class glutathione transferase related to YfcG from Escherichia coli.
20	PDB:5o84A	0.371	0.710	2.698E-9	216	0.098	0.199	5o84A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P26641	0.0	908	437	1.000	1.000	EF1G_HUMAN Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3
2	Q9NJH0	1.10e-161	464	431	0.574	0.582	EF1G_DROME Elongation factor 1-gamma OS=Drosophila melanogaster OX=7227 GN=eEF1gamma PE=2 SV=2
3	B0G141	7.64e-106	321	410	0.432	0.461	B0G141_DICDI Glutathione S-transferase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=efa1G PE=4 SV=1
4	O04487	2.42e-79	253	414	0.375	0.396	EF1G1_ARATH Probable elongation factor 1-gamma 1 OS=Arabidopsis thaliana OX=3702 GN=At1g09640 PE=1 SV=1
5	Q9FVT2	4.36e-72	234	413	0.366	0.387	EF1G2_ARATH Probable elongation factor 1-gamma 2 OS=Arabidopsis thaliana OX=3702 GN=At1g57720 PE=1 SV=1
6	Q5AYR7	1.06e-70	231	411	0.343	0.365	Q5AYR7_EMENI Elongation factor 1-gamma, putative (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06563 PE=4 SV=1
7	P40921	4.68e-62	208	409	0.320	0.342	EF1G_SCHPO Elongation factor 1-gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tef3 PE=1 SV=1
8	P36008	6.22e-61	205	412	0.327	0.347	EF1G2_YEAST Elongation factor 1-gamma 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TEF4 PE=1 SV=1
9	P29547	1.44e-60	204	415	0.302	0.318	EF1G1_YEAST Elongation factor 1-gamma 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAM1 PE=1 SV=2
10	Q4WR90	1.73e-43	154	220	0.192	0.382	Q4WR90_ASPFU Translation elongation factor eEF-1B gamma subunit, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_1G17120 PE=3 SV=1
11	A0A024RCN6	5.70e-31	128	1264	0.204	0.070	A0A024RCN6_HUMAN Valine--tRNA ligase OS=Homo sapiens OX=9606 PE=1 SV=1
12	P26640	5.70e-31	128	1264	0.204	0.070	SYVC_HUMAN Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4
13	Q9Z1Q9	8.27e-29	122	1263	0.188	0.065	SYVC_MOUSE Valine--tRNA ligase OS=Mus musculus OX=10090 GN=Vars1 PE=1 SV=1
14	Q04462	8.94e-28	119	1264	0.190	0.066	SYVC_RAT Valine--tRNA ligase OS=Rattus norvegicus OX=10116 GN=Vars1 PE=2 SV=2
15	O74830	2.46e-16	79.7	220	0.144	0.286	YC12_SCHPO Putative glutathione S-transferase C1183.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1183.02 PE=3 SV=1
16	Q869Z5	9.81e-13	69.7	227	0.121	0.233	Q869Z5_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271892 PE=3 SV=1
17	P12653	1.55e-11	65.9	214	0.133	0.271	GSTF1_MAIZE Glutathione S-transferase 1 OS=Zea mays OX=4577 GN=GST1 PE=1 SV=4
18	P46420	8.95e-11	63.9	223	0.124	0.242	GSTF4_MAIZE Glutathione S-transferase 4 OS=Zea mays OX=4577 GN=GST4 PE=1 SV=2
19	Q9Y7Q2	5.92e-09	58.5	229	0.128	0.245	GST1_SCHPO Glutathione S-transferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gst1 PE=2 SV=1
20	Q12390	6.82e-09	58.5	233	0.087	0.163	GST2_YEAST Glutathione S-transferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GTT2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00647 EF1G	1e-45	165.5	Elongation factor 1 gamma, conserved domain
2	PF00043 GST_C	4.8e-15	66.9	Glutathione S-transferase, C-terminal domain
3	PF13410 GST_C_2	3.9e-05	34.8	Glutathione S-transferase, C-terminal domain
4	PF14497 GST_C_3	0.036	25.6	Glutathione S-transferase, C-terminal domain
5	PF02798 GST_N	1.4e-18	78.3	Glutathione S-transferase, N-terminal domain
6	PF13409 GST_N_2	1.8	20.3	Glutathione S-transferase, N-terminal domain
7	PF13417 GST_N_3	0.014	27.0	Glutathione S-transferase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331901

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339063	0.999	Elongation factor 1-alpha 1
2	9606.ENSP00000376056	0.999	Elongation factor 1-beta
3	9606.ENSP00000410059	0.999	Elongation factor 1-delta
4	9606.ENSP00000369897	0.998	Cysteine--tRNA ligase, cytoplasmic
5	9606.ENSP00000449328	0.998	60S acidic ribosomal protein P0
6	9606.ENSP00000307940	0.997	Elongation factor 2
7	9606.ENSP00000311430	0.997	L ribosomal proteins
8	9606.ENSP00000341885	0.997	Ribosomal protein S2
9	9606.ENSP00000362744	0.994	Ribosomal protein S4, X-linked
10	9606.ENSP00000225430	0.993	Ribosomal protein L19
11	9606.ENSP00000278572	0.993	40S ribosomal protein S3
12	9606.ENSP00000363676	0.993	60S ribosomal protein L11
13	9606.ENSP00000403172	0.991	60S ribosomal protein L6
14	9606.ENSP00000309334	0.990	Ribosomal protein L15
15	9606.ENSP00000346001	0.990	60S ribosomal protein L3
16	9606.ENSP00000346067	0.990	40S ribosomal protein SA
17	9606.ENSP00000379888	0.990	Ribosomal protein S8
18	9606.ENSP00000400467	0.989	L ribosomal proteins
19	9606.ENSP00000426909	0.989	Receptor of activated protein C kinase 1
20	9606.ENSP00000346037	0.987	60S acidic ribosomal protein P1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045296	0.999	cadherin binding
GO:0003824	0.858	catalytic activity
GO:0097159	0.431	organic cyclic compound binding
GO:1901363	0.417	heterocyclic compound binding
GO:0004364	0.410	glutathione transferase activity
GO:0003676	0.402	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.873	response to stimulus
GO:0051707	0.801	response to other organism
GO:0008152	0.790	metabolic process
GO:0009615	0.780	response to virus
GO:0009987	0.777	cellular process
GO:0071704	0.766	organic substance metabolic process
GO:0006807	0.690	nitrogen compound metabolic process
GO:0044238	0.688	primary metabolic process
GO:0044237	0.638	cellular metabolic process
GO:0043170	0.582	macromolecule metabolic process
GO:0034641	0.577	cellular nitrogen compound metabolic process
GO:1901564	0.552	organonitrogen compound metabolic process
GO:1901576	0.541	organic substance biosynthetic process
GO:0010467	0.541	gene expression
GO:0044260	0.537	cellular macromolecule metabolic process
GO:0019538	0.536	protein metabolic process
GO:0044271	0.536	cellular nitrogen compound biosynthetic process
GO:0009059	0.519	macromolecule biosynthetic process
GO:1901566	0.500	organonitrogen compound biosynthetic process
GO:0006518	0.484	peptide metabolic process
GO:0065007	0.472	biological regulation
GO:0043043	0.468	peptide biosynthetic process
GO:0006412	0.459	translation
GO:0050794	0.446	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0005576	0.992	extracellular region
GO:0016020	0.987	membrane
GO:0012505	0.984	endomembrane system
GO:0031982	0.975	vesicle
GO:0070013	0.961	intracellular organelle lumen
GO:0070062	0.950	extracellular exosome
GO:0005783	0.628	endoplasmic reticulum
GO:0032991	0.517	protein-containing complex
GO:0031981	0.406	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.5.1.18	0.410	glutathione transferase.

[back to server]