StarFunc result for job id P26651

User Input

>input (326 residues)
MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTS
LVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRY
GAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPV
LRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPL
ARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFE
AGVFAPPQPVAAPRRLPIFNRISVSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P26651	1.000	1.000	6.814E-52	326	1.000	1.000	P26651.pdb.gz	TTP_HUMAN mRNA decay activator protein ZFP36 OS=Homo sapiens OX=9606 GN=ZFP36 PE=1 SV=1
2	AFDB:P47980	0.216	0.164	4.568E-13	436	0.325	0.243	P47980.pdb.gz	TIS11_DROME Protein TIS11 OS=Drosophila melanogaster OX=7227 GN=Tis11 PE=2 SV=2
3	PDB:6dnhC	0.095	0.225	6.881E-2	117	0.049	0.137	6dnhC.pdb.gz	Molecular basis for the recognition of the human AAUAAA polyadenylation signal.
4	PDB:7dvqM	0.076	0.123	2.936E-1	191	0.049	0.084	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
5	AFDB:P41000	0.137	0.086	3.481E-1	583	0.156	0.087	P41000.pdb.gz	CPS3_SCHPO Protein cps3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cps3 PE=1 SV=3
6	AFDB:Q9V3G8	0.081	0.079	5.268E-1	373	0.120	0.105	Q9V3G8.pdb.gz	Q9V3G8_DROME RH73259p OS=Drosophila melanogaster OX=7227 GN=Vajk1 PE=2 SV=1
7	PDB:5gm6a	0.072	0.180	5.467E-1	123	0.040	0.106	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
8	PDB:6id0O	0.069	0.076	6.727E-1	290	0.049	0.055	6id0O.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
9	AFDB:Q54GR0	0.089	0.040	6.946E-1	1036	0.144	0.045	Q54GR0.pdb.gz	Q54GR0_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0289987 PE=4 SV=1
10	PDB:6ff4t	0.076	0.139	7.208E-1	172	0.064	0.122	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
11	PDB:7abiP	0.061	0.083	1.253	237	0.031	0.042	7abiP.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
12	AFDB:Q57VA5	0.128	0.076	1.386	566	0.172	0.099	Q57VA5.pdb.gz	Q57VA5_TRYB2 C3H1-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.30H13.810 PE=4 SV=1
13	AFDB:J9VI91	0.079	0.036	1.958	950	0.166	0.057	J9VI91.pdb.gz	J9VI91_CRYNH Pumilio-family RNA binding protein OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_02810 PE=4 SV=2
14	AFDB:Q9Y5P3	0.084	0.057	2.248	530	0.215	0.132	Q9Y5P3.pdb.gz	RAI2_HUMAN Retinoic acid-induced protein 2 OS=Homo sapiens OX=9606 GN=RAI2 PE=1 SV=2
15	AFDB:Q9FZH7	0.075	0.036	2.581	826	0.178	0.070	Q9FZH7.pdb.gz	Q9FZH7_ARATH DnaA initiator-associating protein OS=Arabidopsis thaliana OX=3702 GN=TRM22 PE=1 SV=1
16	AFDB:A0A1D8PMZ4	0.068	0.036	3.176	685	0.156	0.074	A0A1D8PMZ4.pdb.gz	A0A1D8PMZ4_CANAL Hms1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HMS1 PE=4 SV=1
17	PDB:7c06A	0.072	0.120	8.669	193	0.031	0.052	7c06A.pdb.gz	Elucidation of the aberrant 3' splice site selection by cancer-associated mutations on the U2AF1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P26651	0.0	629	326	1.000	1.000	TTP_HUMAN mRNA decay activator protein ZFP36 OS=Homo sapiens OX=9606 GN=ZFP36 PE=1 SV=1
2	P22893	3.91e-143	408	319	0.840	0.859	TTP_MOUSE mRNA decay activator protein ZFP36 OS=Mus musculus OX=10090 GN=Zfp36 PE=1 SV=1
3	P47973	2.59e-138	396	320	0.847	0.863	TTP_RAT mRNA decay activator protein ZFP36 OS=Rattus norvegicus OX=10116 GN=Zfp36 PE=1 SV=1
4	Q7ZXW9	4.73e-34	130	363	0.190	0.171	TISDA_XENLA mRNA decay activator protein ZFP36L2-A OS=Xenopus laevis OX=8355 GN=zfp36l2-A PE=1 SV=1
5	P23950	6.06e-34	129	338	0.193	0.186	TISB_MOUSE mRNA decay activator protein ZFP36L1 OS=Mus musculus OX=10090 GN=Zfp36l1 PE=1 SV=1
6	P17431	6.18e-34	129	338	0.193	0.186	TISB_RAT mRNA decay activator protein ZFP36L1 OS=Rattus norvegicus OX=10116 GN=Zfp36l1 PE=1 SV=1
7	Q07352	6.18e-34	129	338	0.193	0.186	TISB_HUMAN mRNA decay activator protein ZFP36L1 OS=Homo sapiens OX=9606 GN=ZFP36L1 PE=1 SV=1
8	Q805B4	9.63e-34	129	364	0.187	0.168	TISDB_XENLA mRNA decay activator protein ZFP36L2-B OS=Xenopus laevis OX=8355 GN=zfp36l2-B PE=1 SV=1
9	P47974	5.78e-31	124	494	0.212	0.140	TISD_HUMAN mRNA decay activator protein ZFP36L2 OS=Homo sapiens OX=9606 GN=ZFP36L2 PE=1 SV=3
10	P23949	8.44e-31	123	484	0.212	0.143	TISD_MOUSE mRNA decay activator protein ZFP36L2 OS=Mus musculus OX=10090 GN=Zfp36l2 PE=1 SV=2
11	Q5ISE2	3.65e-28	117	725	0.178	0.080	Z36L3_MOUSE mRNA decay activator protein ZFP36L3 OS=Mus musculus OX=10090 GN=Zfp36l3 PE=1 SV=1
12	Q54MG5	1.51e-27	113	437	0.144	0.108	Q54MG5_DICDI C3H1-type domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285973 PE=4 SV=2
13	P47980	2.46e-27	112	436	0.144	0.108	TIS11_DROME Protein TIS11 OS=Drosophila melanogaster OX=7227 GN=Tis11 PE=2 SV=2
14	Q7YXD9	8.56e-24	102	419	0.144	0.112	Q7YXD9_CAEEL C3H1-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccch-1 PE=1 SV=1
15	Q20155	9.17e-24	103	460	0.144	0.102	Q20155_CAEEL C3H1-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccch-1 PE=4 SV=3
16	P47979	7.25e-21	94.4	404	0.120	0.097	ZFS1_SCHPO Zinc finger protein zfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=zfs1 PE=1 SV=1
17	Q9C9F5	1.77e-19	89.4	308	0.129	0.136	C3H15_ARATH Zinc finger CCCH domain-containing protein 15 OS=Arabidopsis thaliana OX=3702 GN=C3H15 PE=1 SV=1
18	Q9C9N3	1.12e-17	84.3	310	0.110	0.116	C3H14_ARATH Zinc finger CCCH domain-containing protein 14 OS=Arabidopsis thaliana OX=3702 GN=C3H14 PE=2 SV=1
19	G5EF15	1.38e-17	83.2	264	0.153	0.189	POS1_CAEEL RNA-binding protein pos-1 OS=Caenorhabditis elegans OX=6239 GN=pos-1 PE=1 SV=1
20	P47977	1.03e-16	81.3	285	0.123	0.140	CTH2_YEAST mRNA decay factor CTH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIS11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16131 Torus	2.9	20.0	Torus domain
2	PF00642 zf-CCCH	8.7e-18	75.1	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
3	PF14608 zf-CCCH_2	0.0044	28.8	RNA-binding, Nab2-type zinc finger
4	PF18044 zf-CCCH_4	0.00015	32.8	CCCH-type zinc finger
5	PF18345 zf_CCCH_4	8.2e-10	49.6	Zinc finger domain
6	PF19242 Zn_finger_prot	14	16.9	Putative zinc finger protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000469647

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356070	0.971	MAP kinase-activated protein kinase 2
2	9606.ENSP00000361930	0.959	14-3-3 protein beta/alpha
3	9606.ENSP00000320949	0.952	CCR4-NOT transcription complex subunit 1
4	9606.ENSP00000239223	0.934	Dual specificity protein phosphatase 1
5	9606.ENSP00000264951	0.928	5'-3' exoribonuclease 1
6	9606.ENSP00000320503	0.896	Enhancer of mRNA-decapping protein 3
7	9606.ENSP00000373715	0.896	m7GpppN-mRNA hydrolase
8	9606.ENSP00000306245	0.888	Proto-oncogene c-Fos
9	9606.ENSP00000476046	0.873	mRNA-decapping enzyme 1A
10	9606.ENSP00000381216	0.847	Far upstream element-binding protein 2
11	9606.ENSP00000313199	0.840	Heterogeneous nuclear ribonucleoprotein D0
12	9606.ENSP00000355279	0.832	CCR4-NOT transcription complex subunit 7
13	9606.ENSP00000303315	0.814	Transcription factor jun-B
14	9606.ENSP00000336712	0.813	Transportin-1
15	9606.ENSP00000387170	0.812	GRB10-interacting GYF protein 2
16	9606.ENSP00000398597	0.807	Exosome complex component MTR3
17	9606.ENSP00000385269	0.804	ELAV-like protein 1
18	9606.ENSP00000374354	0.799	Exosome complex component RRP43
19	9606.ENSP00000220592	0.780	Protein argonaute-2
20	9606.ENSP00000245919	0.769	Protein fosB

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003730	1.000	mRNA 3'-UTR binding
GO:0035925	0.988	mRNA 3'-UTR AU-rich region binding
GO:0019899	0.973	enzyme binding
GO:0071889	0.934	14-3-3 protein binding
GO:0019901	0.915	protein kinase binding
GO:0019957	0.900	C-C chemokine binding
GO:0044877	0.881	protein-containing complex binding
GO:0031072	0.856	heat shock protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010468	0.988	regulation of gene expression
GO:0009987	0.987	cellular process
GO:0071704	0.985	organic substance metabolic process
GO:0048518	0.985	positive regulation of biological process
GO:0051252	0.985	regulation of RNA metabolic process
GO:0044238	0.983	primary metabolic process
GO:0048519	0.983	negative regulation of biological process
GO:0031326	0.983	regulation of cellular biosynthetic process
GO:0010556	0.982	regulation of macromolecule biosynthetic process
GO:0048522	0.977	positive regulation of cellular process
GO:0044237	0.974	cellular metabolic process
GO:0048523	0.971	negative regulation of cellular process
GO:0006807	0.963	nitrogen compound metabolic process
GO:0051248	0.963	negative regulation of protein metabolic process
GO:0043170	0.954	macromolecule metabolic process
GO:0061157	0.946	mRNA destabilization
GO:0050896	0.928	response to stimulus
GO:0000956	0.925	nuclear-transcribed mRNA catabolic process
GO:0051716	0.901	cellular response to stimulus
GO:0000288	0.900	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:2001141	0.782	regulation of RNA biosynthetic process
GO:0007154	0.773	cell communication
GO:0045934	0.743	negative regulation of nucleobase-containing compound metabolic process
GO:0070887	0.716	cellular response to chemical stimulus
GO:0006355	0.713	regulation of DNA-templated transcription
GO:0007165	0.702	signal transduction
GO:0006950	0.697	response to stress
GO:0051253	0.495	negative regulation of RNA metabolic process
GO:0010033	0.445	response to organic substance
GO:0051239	0.444	regulation of multicellular organismal process
GO:0006357	0.436	regulation of transcription by RNA polymerase II
GO:0071310	0.430	cellular response to organic substance
GO:0035556	0.382	intracellular signal transduction
GO:0050793	0.372	regulation of developmental process
GO:0071495	0.352	cellular response to endogenous stimulus
GO:0045595	0.324	regulation of cell differentiation
GO:1901701	0.318	cellular response to oxygen-containing compound
GO:2000026	0.314	regulation of multicellular organismal development
GO:1903507	0.300	negative regulation of nucleic acid-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005634	0.999	nucleus
GO:0005829	0.994	cytosol
GO:0032991	0.989	protein-containing complex
GO:0043232	0.987	intracellular non-membrane-bounded organelle
GO:0031981	0.941	nuclear lumen
GO:0036464	0.903	cytoplasmic ribonucleoprotein granule
GO:0005654	0.901	nucleoplasm
GO:1902494	0.704	catalytic complex
GO:1990904	0.687	ribonucleoprotein complex
GO:0140535	0.676	intracellular protein-containing complex
GO:0000932	0.600	P-body
GO:0010494	0.394	cytoplasmic stress granule
GO:0070578	0.380	RISC-loading complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]