StarFunc result for job id P26715

User Input

>input (233 residues)
MDNQGVIYSDLNLPPNPKRQQRKPKGNKNSILATEQEITYAELNLQKASQDFQGNDKTYH
CKDLPSAPEKLIVGILGIICLILMASVVTIVVIPSTLIQRHNNSSLNTRTQKARHCGHCP
EEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRN
SSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P26715	1.000	1.000	4.122E-44	233	1.000	1.000	P26715.pdb.gz	NKG2A_HUMAN NKG2-A/NKG2-B type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC1 PE=1 SV=2
2	AFDB:P26717	0.582	0.587	2.493E-30	231	0.768	0.775	P26717.pdb.gz	NKG2C_HUMAN NKG2-C type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC2 PE=1 SV=3
3	AFDB:Q07444	0.496	0.483	1.762E-26	240	0.695	0.675	Q07444.pdb.gz	NKG2E_HUMAN NKG2-E type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC3 PE=2 SV=3
4	AFDB:A6H5Z4	0.473	0.453	2.393E-19	244	0.412	0.393	A6H5Z4.pdb.gz	A6H5Z4_MOUSE Klrc1 protein OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
5	AFDB:D3YXP2	0.470	0.494	3.407E-17	221	0.309	0.326	D3YXP2.pdb.gz	D3YXP2_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=4 SV=1
6	AFDB:A1L3Q6	0.478	0.454	8.631E-17	246	0.322	0.305	A1L3Q6.pdb.gz	A1L3Q6_MOUSE Klrc3 protein OS=Mus musculus OX=10090 GN=Klrc3 PE=2 SV=1
7	AFDB:E9QAJ6	0.473	0.523	1.039E-16	210	0.348	0.386	E9QAJ6.pdb.gz	E9QAJ6_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=4 SV=1
8	AFDB:Q80ZC8	0.515	0.529	5.111E-14	226	0.249	0.257	Q80ZC8.pdb.gz	KLRE1_RAT Killer cell lectin-like receptor subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Klre1 PE=1 SV=1
9	AFDB:Q0ZUP1	0.472	0.511	1.466E-13	214	0.227	0.248	Q0ZUP1.pdb.gz	KLRB1_MOUSE Killer cell lectin-like receptor subfamily B member 1 OS=Mus musculus OX=10090 GN=Klrb1 PE=2 SV=1
10	AFDB:Q9BXN2	0.467	0.442	1.560E-13	247	0.253	0.239	Q9BXN2.pdb.gz	CLC7A_HUMAN C-type lectin domain family 7 member A OS=Homo sapiens OX=9606 GN=CLEC7A PE=1 SV=1
11	PDB:7wz8A	0.422	0.535	2.878E-10	180	0.137	0.178	7wz8A.pdb.gz
12	PDB:1qddA	0.455	0.708	1.048E-8	144	0.133	0.215	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
13	PDB:4mthA	0.425	0.679	2.824E-8	139	0.133	0.223	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
14	PDB:1htnA	0.432	0.629	5.585E-8	156	0.107	0.160	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
15	PDB:5f2qB	0.434	0.718	7.614E-8	135	0.107	0.185	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
16	PDB:7qsrA	0.428	0.080	7.614E-8	1335	0.137	0.024	7qsrA.pdb.gz
17	PDB:3bx4C	0.375	0.632	4.059E-7	134	0.120	0.209	3bx4C.pdb.gz
18	PDB:7jptA	0.418	0.079	4.059E-7	1327	0.124	0.022	7jptA.pdb.gz
19	PDB:1gz2A	0.423	0.676	1.164E-6	139	0.099	0.165	1gz2A.pdb.gz
20	PDB:1bj3B	0.377	0.688	1.492E-6	123	0.103	0.195	1bj3B.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P26715	3.65e-176	484	233	1.000	1.000	NKG2A_HUMAN NKG2-A/NKG2-B type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC1 PE=1 SV=2
2	P26717	7.08e-127	360	231	0.764	0.771	NKG2C_HUMAN NKG2-C type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC2 PE=1 SV=3
3	Q07444	3.44e-108	313	240	0.691	0.671	NKG2E_HUMAN NKG2-E type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC3 PE=2 SV=3
4	Q9Z202	3.21e-56	181	244	0.433	0.414	Q9Z202_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
5	A6H5Z4	2.52e-55	179	244	0.433	0.414	A6H5Z4_MOUSE Klrc1 protein OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
6	Q9WU31	2.55e-55	179	244	0.416	0.398	Q9WU31_MOUSE Natural killer cell receptor NKG2A OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
7	Q9WU32	5.46e-55	177	227	0.408	0.419	Q9WU32_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
8	E9QAJ6	1.59e-43	147	210	0.352	0.390	E9QAJ6_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=4 SV=1
9	Q9WVJ8	3.18e-43	147	210	0.352	0.390	Q9WVJ8_MOUSE Natural killer cell protein group 2-A2 OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
10	A1L3Q6	4.21e-42	145	246	0.356	0.337	A1L3Q6_MOUSE Klrc3 protein OS=Mus musculus OX=10090 GN=Klrc3 PE=2 SV=1
11	Q9WTJ9	1.22e-41	143	238	0.348	0.340	Q9WTJ9_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=2 SV=1
12	Q9QXN7	5.05e-41	141	221	0.335	0.353	Q9QXN7_MOUSE Killer cell lectin-like receptor subfamily C, member 3 OS=Mus musculus OX=10090 GN=Klrc3 PE=2 SV=1
13	D3YXP2	2.86e-40	139	221	0.330	0.348	D3YXP2_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=4 SV=1
14	L7N477	7.51e-39	135	213	0.330	0.362	L7N477_MOUSE Killer cell lectin-like receptor subfamily C, member 3 OS=Mus musculus OX=10090 GN=Klrc3 PE=4 SV=1
15	Q9WVJ7	1.98e-38	134	213	0.326	0.357	Q9WVJ7_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=2 SV=1
16	Q8CB89	1.08e-35	127	206	0.292	0.330	Q8CB89_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=2 SV=1
17	Q13241	3.94e-20	86.3	179	0.197	0.257	KLRD1_HUMAN Natural killer cells antigen CD94 OS=Homo sapiens OX=9606 GN=KLRD1 PE=1 SV=2
18	Q80ZC8	4.68e-20	87.0	226	0.253	0.261	KLRE1_RAT Killer cell lectin-like receptor subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Klre1 PE=1 SV=1
19	Q5DT39	1.90e-19	85.9	243	0.258	0.247	KLRI1_RAT Killer cell lectin-like receptor subfamily I member 1 OS=Rattus norvegicus OX=10116 GN=Klri1 PE=1 SV=1
20	Q8CJC7	9.18e-19	83.6	226	0.258	0.265	KLRE1_MOUSE Killer cell lectin-like receptor subfamily E member 1 OS=Mus musculus OX=10090 GN=Klre1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05966 Chordopox_A33R	21	15.8	Chordopoxvirus A33R protein
2	PF00059 Lectin_C	1.2e-05	37.3	Lectin C-type domain
3	PF05473 UL45	2.7e-05	35.5	UL45 protein, carbohydrate-binding C-type lectin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000438038

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365817	0.999	HLA class I histocompatibility antigen, alpha chain E
2	9606.ENSP00000371333	0.997	Natural killer cells antigen CD94
3	9606.ENSP00000452780	0.997	Beta-2-microglobulin
4	9606.ENSP00000412927	0.985	HLA class I histocompatibility antigen, alpha chain G
5	9606.ENSP00000391592	0.984	Tyrosine-protein phosphatase non-receptor type 6
6	9606.ENSP00000379873	0.978	HLA class I histocompatibility antigen, A-3 alpha chain
7	9606.ENSP00000336769	0.972	Killer cell immunoglobulin-like receptor 2DL1
8	9606.ENSP00000375608	0.972	Killer cell immunoglobulin-like receptor 3DL1
9	9606.ENSP00000342215	0.971	Killer cell immunoglobulin-like receptor 2DL3
10	9606.ENSP00000325525	0.950	Killer cell immunoglobulin-like receptor 3DL2
11	9606.ENSP00000291860	0.947	Killer cell immunoglobulin-like receptor 3DL3
12	9606.ENSP00000371327	0.925	NKG2-C type II integral membrane protein
13	9606.ENSP00000340944	0.917	Tyrosine-protein phosphatase non-receptor type 11
14	9606.ENSP00000310216	0.912	NKG2-F type II integral membrane protein
15	9606.ENSP00000365402	0.900	HLA class I histocompatibility antigen, Cw-7 alpha chain
16	9606.ENSP00000291890	0.867	Natural cytotoxicity triggering receptor 1
17	9606.ENSP00000342156	0.863	Natural cytotoxicity triggering receptor 3
18	9606.ENSP00000399168	0.862	HLA class I histocompatibility antigen, B-7 alpha chain
19	9606.ENSP00000362181	0.833	Natural cytotoxicity triggering receptor 2
20	9606.ENSP00000480132	0.822	Neural cell adhesion molecule 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004888	1.000	transmembrane signaling receptor activity
GO:0140375	0.999	immune receptor activity
GO:0023023	0.995	MHC protein complex binding
GO:0042802	0.467	identical protein binding
GO:0032394	0.418	MHC class Ib receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050896	0.997	response to stimulus
GO:0050789	0.997	regulation of biological process
GO:0023052	0.995	signaling
GO:0050794	0.994	regulation of cellular process
GO:0007154	0.988	cell communication
GO:0050776	0.987	regulation of immune response
GO:0051716	0.985	cellular response to stimulus
GO:0002376	0.983	immune system process
GO:0007165	0.979	signal transduction
GO:0002703	0.967	regulation of leukocyte mediated immunity
GO:0048518	0.965	positive regulation of biological process
GO:0031347	0.957	regulation of defense response
GO:0031341	0.953	regulation of cell killing
GO:0045088	0.947	regulation of innate immune response
GO:0007166	0.939	cell surface receptor signaling pathway
GO:0002706	0.931	regulation of lymphocyte mediated immunity
GO:0001910	0.929	regulation of leukocyte mediated cytotoxicity
GO:0032501	0.924	multicellular organismal process
GO:0002715	0.905	regulation of natural killer cell mediated immunity
GO:0002768	0.899	immune response-regulating cell surface receptor signaling pathway
GO:0042269	0.894	regulation of natural killer cell mediated cytotoxicity
GO:0002684	0.879	positive regulation of immune system process
GO:0001775	0.876	cell activation
GO:0002683	0.850	negative regulation of immune system process
GO:0002698	0.836	negative regulation of immune effector process
GO:0048522	0.820	positive regulation of cellular process
GO:0050777	0.814	negative regulation of immune response
GO:0002707	0.785	negative regulation of lymphocyte mediated immunity
GO:0031342	0.759	negative regulation of cell killing
GO:0001911	0.751	negative regulation of leukocyte mediated cytotoxicity
GO:0046649	0.731	lymphocyte activation
GO:0048584	0.720	positive regulation of response to stimulus
GO:0032102	0.720	negative regulation of response to external stimulus
GO:0051239	0.696	regulation of multicellular organismal process
GO:0032502	0.644	developmental process
GO:0050778	0.641	positive regulation of immune response
GO:0048856	0.614	anatomical structure development
GO:0031348	0.540	negative regulation of defense response
GO:0002694	0.516	regulation of leukocyte activation
GO:0002832	0.454	negative regulation of response to biotic stimulus
GO:0006950	0.450	response to stress
GO:0006955	0.444	immune response
GO:0051240	0.426	positive regulation of multicellular organismal process
GO:0006952	0.415	defense response
GO:0002699	0.400	positive regulation of immune effector process
GO:0051249	0.400	regulation of lymphocyte activation
GO:0002819	0.377	regulation of adaptive immune response
GO:0002822	0.368	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0032103	0.349	positive regulation of response to external stimulus
GO:0031349	0.348	positive regulation of defense response
GO:0002757	0.341	immune response-activating signaling pathway
GO:0042110	0.337	T cell activation
GO:0030154	0.326	cell differentiation
GO:0019222	0.311	regulation of metabolic process
GO:0045824	0.309	negative regulation of innate immune response
GO:0009605	0.307	response to external stimulus
GO:0002252	0.305	immune effector process
GO:0044419	0.302	biological process involved in interspecies interaction between organisms
GO:0009607	0.301	response to biotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.953	protein-containing complex
GO:0009986	0.806	cell surface
GO:0043235	0.744	receptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]