StarFunc result for job id P26717

User Input

>input (231 residues)
MSKQRGTFSEVSLAQDPKRQQRKPKGNKSSISGTEQEIFQVELNLQNPSLNHQGIDKIYD
CQGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPFLEQNNSSPNTRTQKARHCGHCPEE
WITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSS
HHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P26717	1.000	1.000	5.199E-43	231	1.000	1.000	P26717.pdb.gz	NKG2C_HUMAN NKG2-C type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC2 PE=1 SV=3
2	AFDB:Q07444	0.527	0.508	2.477E-32	240	0.905	0.871	Q07444.pdb.gz	NKG2E_HUMAN NKG2-E type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC3 PE=2 SV=3
3	AFDB:P26715	0.583	0.579	1.251E-29	233	0.727	0.721	P26715.pdb.gz	NKG2A_HUMAN NKG2-A/NKG2-B type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC1 PE=1 SV=2
4	AFDB:A6H5Z4	0.486	0.461	1.824E-22	244	0.433	0.410	A6H5Z4.pdb.gz	A6H5Z4_MOUSE Klrc1 protein OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
5	AFDB:A1L3Q6	0.493	0.464	1.338E-19	246	0.338	0.317	A1L3Q6.pdb.gz	A1L3Q6_MOUSE Klrc3 protein OS=Mus musculus OX=10090 GN=Klrc3 PE=2 SV=1
6	AFDB:D3YXP2	0.467	0.487	1.339E-18	221	0.320	0.335	D3YXP2.pdb.gz	D3YXP2_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=4 SV=1
7	AFDB:E9QAJ6	0.489	0.536	1.260E-15	210	0.351	0.386	E9QAJ6.pdb.gz	E9QAJ6_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=4 SV=1
8	AFDB:Q07108	0.474	0.541	6.356E-15	199	0.190	0.221	Q07108.pdb.gz	CD69_HUMAN Early activation antigen CD69 OS=Homo sapiens OX=9606 GN=CD69 PE=1 SV=1
9	AFDB:Q9WVF9	0.462	0.490	4.113E-14	217	0.177	0.189	Q9WVF9.pdb.gz	CLC2I_MOUSE C-type lectin domain family 2 member I OS=Mus musculus OX=10090 GN=Clec2i PE=1 SV=1
10	AFDB:Q96E93	0.466	0.548	6.359E-14	195	0.216	0.256	Q96E93.pdb.gz	KLRG1_HUMAN Killer cell lectin-like receptor subfamily G member 1 OS=Homo sapiens OX=9606 GN=KLRG1 PE=1 SV=1
11	PDB:7wz8A	0.431	0.544	5.763E-10	180	0.130	0.167	7wz8A.pdb.gz
12	PDB:1qddA	0.451	0.699	3.293E-9	144	0.160	0.257	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
13	PDB:1htnA	0.451	0.655	2.413E-8	156	0.121	0.179	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
14	PDB:4mthA	0.436	0.693	4.226E-8	139	0.121	0.201	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
15	PDB:7qsrA	0.443	0.081	6.139E-8	1335	0.147	0.025	7qsrA.pdb.gz
16	PDB:5f2qB	0.435	0.712	8.380E-8	135	0.113	0.193	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
17	PDB:1gz2A	0.425	0.676	3.296E-7	139	0.108	0.180	1gz2A.pdb.gz
18	PDB:2kv3A	0.417	0.685	1.296E-6	131	0.121	0.214	2kv3A.pdb.gz
19	PDB:7jptA	0.431	0.081	1.468E-6	1327	0.121	0.021	7jptA.pdb.gz
20	PDB:1bj3B	0.390	0.706	1.883E-6	123	0.117	0.220	1bj3B.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P26717	5.74e-173	476	231	0.991	0.991	NKG2C_HUMAN NKG2-C type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC2 PE=1 SV=3
2	Q07444	1.56e-151	422	240	0.900	0.867	NKG2E_HUMAN NKG2-E type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC3 PE=2 SV=3
3	P26715	9.14e-128	362	233	0.775	0.768	NKG2A_HUMAN NKG2-A/NKG2-B type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC1 PE=1 SV=2
4	Q9WU31	2.39e-57	184	244	0.442	0.418	Q9WU31_MOUSE Natural killer cell receptor NKG2A OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
5	Q9Z202	4.35e-57	183	244	0.450	0.426	Q9Z202_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
6	Q9WU32	1.01e-56	182	227	0.424	0.432	Q9WU32_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
7	A6H5Z4	2.65e-55	179	244	0.446	0.422	A6H5Z4_MOUSE Klrc1 protein OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
8	E9QAJ6	1.98e-43	147	210	0.364	0.400	E9QAJ6_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=4 SV=1
9	Q9WVJ8	1.37e-42	145	210	0.364	0.400	Q9WVJ8_MOUSE Natural killer cell protein group 2-A2 OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
10	Q9QXN7	1.50e-40	140	221	0.342	0.357	Q9QXN7_MOUSE Killer cell lectin-like receptor subfamily C, member 3 OS=Mus musculus OX=10090 GN=Klrc3 PE=2 SV=1
11	A1L3Q6	4.16e-40	139	246	0.364	0.341	A1L3Q6_MOUSE Klrc3 protein OS=Mus musculus OX=10090 GN=Klrc3 PE=2 SV=1
12	Q9WTJ9	1.50e-39	138	238	0.355	0.345	Q9WTJ9_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=2 SV=1
13	D3YXP2	1.79e-39	137	221	0.338	0.353	D3YXP2_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=4 SV=1
14	L7N477	4.35e-37	131	213	0.329	0.357	L7N477_MOUSE Killer cell lectin-like receptor subfamily C, member 3 OS=Mus musculus OX=10090 GN=Klrc3 PE=4 SV=1
15	Q9WVJ7	9.73e-37	130	213	0.333	0.362	Q9WVJ7_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=2 SV=1
16	Q8CB89	5.18e-33	120	206	0.307	0.345	Q8CB89_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=2 SV=1
17	Q80ZC8	4.52e-20	87.0	226	0.195	0.199	KLRE1_RAT Killer cell lectin-like receptor subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Klre1 PE=1 SV=1
18	Q13241	1.05e-19	85.1	179	0.199	0.257	KLRD1_HUMAN Natural killer cells antigen CD94 OS=Homo sapiens OX=9606 GN=KLRD1 PE=1 SV=2
19	Q8CJC7	1.15e-17	80.5	226	0.199	0.204	KLRE1_MOUSE Killer cell lectin-like receptor subfamily E member 1 OS=Mus musculus OX=10090 GN=Klre1 PE=1 SV=1
20	Q9EPB2	6.62e-15	73.9	265	0.225	0.196	Q9EPB2_MOUSE Natural killer cell receptor LY49W2 OS=Mus musculus OX=10090 GN=Klra23 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05966 Chordopox_A33R	33	15.2	Chordopoxvirus A33R protein
2	PF00059 Lectin_C	9.1e-07	40.9	Lectin C-type domain
3	PF05473 UL45	0.1	23.8	UL45 protein, carbohydrate-binding C-type lectin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371327

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365817	0.999	HLA class I histocompatibility antigen, alpha chain E
2	9606.ENSP00000262629	0.998	TYRO protein tyrosine kinase-binding protein
3	9606.ENSP00000371333	0.980	Natural killer cells antigen CD94
4	9606.ENSP00000452780	0.972	Beta-2-microglobulin
5	9606.ENSP00000379873	0.962	HLA class I histocompatibility antigen, A-3 alpha chain
6	9606.ENSP00000336769	0.960	Killer cell immunoglobulin-like receptor 2DL1
7	9606.ENSP00000342215	0.960	Killer cell immunoglobulin-like receptor 2DL3
8	9606.ENSP00000375608	0.952	Killer cell immunoglobulin-like receptor 3DL1
9	9606.ENSP00000325525	0.933	Killer cell immunoglobulin-like receptor 3DL2
10	9606.ENSP00000291860	0.932	Killer cell immunoglobulin-like receptor 3DL3
11	9606.ENSP00000310216	0.925	NKG2-F type II integral membrane protein
12	9606.ENSP00000438038	0.925	NKG2-A/NKG2-B type II integral membrane protein
13	9606.ENSP00000391592	0.909	Tyrosine-protein phosphatase non-receptor type 6
14	9606.ENSP00000412927	0.908	HLA class I histocompatibility antigen, alpha chain G
15	9606.ENSP00000365402	0.868	HLA class I histocompatibility antigen, Cw-7 alpha chain
16	9606.ENSP00000342156	0.826	Natural cytotoxicity triggering receptor 3
17	9606.ENSP00000291890	0.818	Natural cytotoxicity triggering receptor 1
18	9606.ENSP00000399168	0.813	HLA class I histocompatibility antigen, B-7 alpha chain
19	9606.ENSP00000362181	0.805	Natural cytotoxicity triggering receptor 2
20	9606.ENSP00000437563	0.802	Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140375	1.000	immune receptor activity
GO:0023023	1.000	MHC protein complex binding
GO:0004888	1.000	transmembrane signaling receptor activity
GO:0003823	0.635	antigen binding
GO:0032394	0.508	MHC class Ib receptor activity
GO:0042802	0.435	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.990	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0048583	0.986	regulation of response to stimulus
GO:0002682	0.983	regulation of immune system process
GO:0007165	0.975	signal transduction
GO:0050776	0.974	regulation of immune response
GO:0007166	0.955	cell surface receptor signaling pathway
GO:0002706	0.954	regulation of lymphocyte mediated immunity
GO:0045088	0.947	regulation of innate immune response
GO:0031341	0.938	regulation of cell killing
GO:0006950	0.921	response to stress
GO:0002376	0.918	immune system process
GO:0002715	0.918	regulation of natural killer cell mediated immunity
GO:0001910	0.916	regulation of leukocyte mediated cytotoxicity
GO:0051239	0.903	regulation of multicellular organismal process
GO:0002768	0.899	immune response-regulating cell surface receptor signaling pathway
GO:0002699	0.892	positive regulation of immune effector process
GO:0031349	0.889	positive regulation of defense response
GO:0042269	0.884	regulation of natural killer cell mediated cytotoxicity
GO:0006952	0.878	defense response
GO:0002717	0.872	positive regulation of natural killer cell mediated immunity
GO:0002253	0.866	activation of immune response
GO:0002429	0.860	immune response-activating cell surface receptor signaling pathway
GO:0001912	0.856	positive regulation of leukocyte mediated cytotoxicity
GO:0006968	0.823	cellular defense response
GO:0060627	0.818	regulation of vesicle-mediated transport
GO:0051050	0.805	positive regulation of transport
GO:0002694	0.750	regulation of leukocyte activation
GO:0045954	0.748	positive regulation of natural killer cell mediated cytotoxicity
GO:0051249	0.744	regulation of lymphocyte activation
GO:0002252	0.615	immune effector process
GO:0032501	0.597	multicellular organismal process
GO:0048519	0.596	negative regulation of biological process
GO:0051240	0.580	positive regulation of multicellular organismal process
GO:0001775	0.553	cell activation
GO:0051251	0.540	positive regulation of lymphocyte activation
GO:0045921	0.519	positive regulation of exocytosis
GO:0006955	0.499	immune response
GO:0048523	0.487	negative regulation of cellular process
GO:0045321	0.421	leukocyte activation
GO:1903305	0.410	regulation of regulated secretory pathway
GO:0009605	0.407	response to external stimulus
GO:0009607	0.404	response to biotic stimulus
GO:0044419	0.362	biological process involved in interspecies interaction between organisms
GO:0002683	0.345	negative regulation of immune system process
GO:0032502	0.341	developmental process
GO:0051707	0.341	response to other organism
GO:0019222	0.330	regulation of metabolic process
GO:1903307	0.321	positive regulation of regulated secretory pathway
GO:0043300	0.320	regulation of leukocyte degranulation
GO:0048856	0.311	anatomical structure development
GO:0046649	0.301	lymphocyte activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.976	protein-containing complex
GO:0009986	0.828	cell surface
GO:0043235	0.801	receptor complex
GO:0098552	0.526	side of membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]