StarFunc result for job id P26718

User Input

>input (216 residues)
MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIA
VAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNW
YESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLT
IIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RAP8	0.596	0.596	4.451E-38	216	0.995	0.995	A0A024RAP8.pdb.gz
2	AFDB:O70215	0.689	0.692	2.095E-26	215	0.560	0.563	O70215.pdb.gz	NKG2D_RAT NKG2-D type II integral membrane protein OS=Rattus norvegicus OX=10116 GN=Klrk1 PE=2 SV=1
3	AFDB:O54709	0.572	0.534	5.360E-25	232	0.574	0.534	O54709.pdb.gz	NKG2D_MOUSE NKG2-D type II integral membrane protein OS=Mus musculus OX=10090 GN=Klrk1 PE=1 SV=2
4	AFDB:Q8C1T8	0.494	0.490	4.289E-13	218	0.218	0.216	Q8C1T8.pdb.gz	CLC2H_MOUSE C-type lectin domain family 2 member H OS=Mus musculus OX=10090 GN=Clec2h PE=2 SV=1
5	AFDB:Q9TTK7	0.510	0.407	4.826E-13	274	0.273	0.215	Q9TTK7.pdb.gz	OLR1_PIG Oxidized low-density lipoprotein receptor 1 OS=Sus scrofa OX=9823 GN=OLR1 PE=2 SV=1
6	AFDB:D3YXP2	0.479	0.469	7.290E-13	221	0.269	0.262	D3YXP2.pdb.gz	D3YXP2_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=4 SV=1
7	AFDB:A6H5Z4	0.469	0.418	9.789E-13	244	0.264	0.234	A6H5Z4.pdb.gz	A6H5Z4_MOUSE Klrc1 protein OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
8	AFDB:Q0ZUP1	0.499	0.503	1.101E-12	214	0.204	0.206	Q0ZUP1.pdb.gz	KLRB1_MOUSE Killer cell lectin-like receptor subfamily B member 1 OS=Mus musculus OX=10090 GN=Klrb1 PE=2 SV=1
9	AFDB:Q91V08	0.483	0.503	1.394E-12	207	0.199	0.208	Q91V08.pdb.gz	CLC2D_MOUSE C-type lectin domain family 2 member D OS=Mus musculus OX=10090 GN=Clec2d PE=1 SV=1
10	AFDB:P27812	0.494	0.479	1.765E-12	223	0.245	0.238	P27812.pdb.gz	KRBBA_MOUSE Killer cell lectin-like receptor subfamily B member 1B allele A OS=Mus musculus OX=10090 GN=Klrb1b PE=1 SV=1
11	PDB:1qddA	0.453	0.655	1.201E-8	144	0.139	0.208	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
12	PDB:7wz8A	0.471	0.558	1.711E-8	180	0.176	0.211	7wz8A.pdb.gz
13	PDB:1gz2A	0.452	0.676	4.142E-8	139	0.130	0.201	1gz2A.pdb.gz
14	PDB:4mthA	0.453	0.675	5.900E-8	139	0.153	0.237	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
15	PDB:7qsrA	0.446	0.078	2.575E-7	1335	0.148	0.024	7qsrA.pdb.gz
16	PDB:3bx4C	0.404	0.631	4.377E-7	134	0.162	0.261	3bx4C.pdb.gz
17	PDB:5f2qB	0.455	0.697	4.925E-7	135	0.130	0.207	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
18	PDB:1bj3A	0.392	0.629	7.014E-7	129	0.157	0.264	1bj3A.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
19	PDB:1bj3B	0.395	0.665	1.265E-6	123	0.148	0.260	1bj3B.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
20	PDB:7jptA	0.451	0.081	1.910E-6	1327	0.139	0.023	7jptA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P26718	7.88e-164	452	216	0.995	0.995	NKG2D_HUMAN NKG2-D type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRK1 PE=1 SV=2
2	O54709	2.62e-86	256	232	0.597	0.556	NKG2D_MOUSE NKG2-D type II integral membrane protein OS=Mus musculus OX=10090 GN=Klrk1 PE=1 SV=2
3	O70215	1.60e-84	251	215	0.560	0.563	NKG2D_RAT NKG2-D type II integral membrane protein OS=Rattus norvegicus OX=10116 GN=Klrk1 PE=2 SV=1
4	Q80ZC8	6.56e-21	89.0	226	0.255	0.243	KLRE1_RAT Killer cell lectin-like receptor subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Klre1 PE=1 SV=1
5	Q9WVJ7	1.26e-19	85.1	213	0.218	0.221	Q9WVJ7_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=2 SV=1
6	Q2HXU8	3.45e-19	85.5	276	0.236	0.185	CL12B_HUMAN C-type lectin domain family 12 member B OS=Homo sapiens OX=9606 GN=CLEC12B PE=1 SV=1
7	D3YXP2	7.87e-19	83.2	221	0.218	0.213	D3YXP2_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=4 SV=1
8	Q13241	1.52e-18	81.6	179	0.218	0.263	KLRD1_HUMAN Natural killer cells antigen CD94 OS=Homo sapiens OX=9606 GN=KLRD1 PE=1 SV=2
9	Q9WTJ9	2.23e-18	82.4	238	0.199	0.181	Q9WTJ9_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=2 SV=1
10	O54707	2.51e-18	80.9	179	0.213	0.257	KLRD1_MOUSE Natural killer cells antigen CD94 OS=Mus musculus OX=10090 GN=Klrd1 PE=2 SV=1
11	Q8CJC7	4.64e-18	81.3	226	0.213	0.204	KLRE1_MOUSE Killer cell lectin-like receptor subfamily E member 1 OS=Mus musculus OX=10090 GN=Klre1 PE=1 SV=1
12	A6H5Z4	6.38e-18	81.3	244	0.194	0.172	A6H5Z4_MOUSE Klrc1 protein OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
13	E9QAJ6	8.43e-18	80.5	210	0.194	0.200	E9QAJ6_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=4 SV=1
14	Q9WU32	1.24e-17	80.1	227	0.194	0.185	Q9WU32_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
15	Q9Z202	1.44e-17	80.5	244	0.194	0.172	Q9Z202_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
16	Q9WVJ8	1.46e-17	79.7	210	0.194	0.200	Q9WVJ8_MOUSE Natural killer cell protein group 2-A2 OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
17	L7N477	2.44e-17	79.0	213	0.204	0.207	L7N477_MOUSE Killer cell lectin-like receptor subfamily C, member 3 OS=Mus musculus OX=10090 GN=Klrc3 PE=4 SV=1
18	A1L3Q6	4.41e-17	79.0	246	0.208	0.183	A1L3Q6_MOUSE Klrc3 protein OS=Mus musculus OX=10090 GN=Klrc3 PE=2 SV=1
19	F5H7N8	7.53e-17	77.8	214	0.222	0.224	F5H7N8_HUMAN Oxidized low density lipoprotein receptor 1 (Fragment) OS=Homo sapiens OX=9606 GN=OLR1 PE=1 SV=1
20	Q9WU31	8.51e-17	78.2	244	0.190	0.168	Q9WU31_MOUSE Natural killer cell receptor NKG2A OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05966 Chordopox_A33R	3.7	18.3	Chordopoxvirus A33R protein
2	PF00059 Lectin_C	5.5e-14	64.1	Lectin C-type domain
3	PF05473 UL45	0.063	24.4	UL45 protein, carbohydrate-binding C-type lectin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480609

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000413079	0.999	MHC class I polypeptide-related sequence A
2	9606.ENSP00000262629	0.997	TYRO protein tyrosine kinase-binding protein
3	9606.ENSP00000356308	0.997	UL16-binding protein 3
4	9606.ENSP00000246551	0.996	Hematopoietic cell signal transducer
5	9606.ENSP00000252229	0.994	MHC class I polypeptide-related sequence B
6	9606.ENSP00000229708	0.990	UL16-binding protein 1
7	9606.ENSP00000356310	0.989	UL16-binding protein 6
8	9606.ENSP00000356320	0.988	UL16-binding protein 2
9	9606.ENSP00000291890	0.942	Natural cytotoxicity triggering receptor 1
10	9606.ENSP00000280200	0.941	CD226 antigen
11	9606.ENSP00000342156	0.903	Natural cytotoxicity triggering receptor 3
12	9606.ENSP00000362181	0.892	Natural cytotoxicity triggering receptor 2
13	9606.ENSP00000354782	0.859	T-cell surface glycoprotein CD3 zeta chain
14	9606.ENSP00000480132	0.855	Neural cell adhesion molecule 1
15	9606.ENSP00000398568	0.849	Perforin-1
16	9606.ENSP00000349709	0.843	Retinoic acid early transcript 1E
17	9606.ENSP00000336769	0.829	Killer cell immunoglobulin-like receptor 2DL1
18	9606.ENSP00000240618	0.826	Killer cell lectin-like receptor subfamily K, member 1
19	9606.ENSP00000342215	0.825	Killer cell immunoglobulin-like receptor 2DL3
20	9606.ENSP00000386559	0.822	T-cell surface glycoprotein CD8 alpha chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0038023	0.986	signaling receptor activity
GO:0004888	0.896	transmembrane signaling receptor activity
GO:0042802	0.804	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048522	0.996	positive regulation of cellular process
GO:0031347	0.995	regulation of defense response
GO:0002684	0.995	positive regulation of immune system process
GO:0032103	0.995	positive regulation of response to external stimulus
GO:0050778	0.994	positive regulation of immune response
GO:0031341	0.993	regulation of cell killing
GO:0002703	0.993	regulation of leukocyte mediated immunity
GO:0045088	0.993	regulation of innate immune response
GO:0007165	0.986	signal transduction
GO:0031349	0.985	positive regulation of defense response
GO:0031343	0.984	positive regulation of cell killing
GO:0051239	0.983	regulation of multicellular organismal process
GO:0042269	0.979	regulation of natural killer cell mediated cytotoxicity
GO:0002717	0.976	positive regulation of natural killer cell mediated immunity
GO:0051240	0.973	positive regulation of multicellular organismal process
GO:0006950	0.972	response to stress
GO:0045954	0.968	positive regulation of natural killer cell mediated cytotoxicity
GO:0032501	0.961	multicellular organismal process
GO:0044419	0.958	biological process involved in interspecies interaction between organisms
GO:0009607	0.955	response to biotic stimulus
GO:0006952	0.939	defense response
GO:0009605	0.937	response to external stimulus
GO:0051707	0.915	response to other organism
GO:0019222	0.913	regulation of metabolic process
GO:0002696	0.907	positive regulation of leukocyte activation
GO:0045321	0.906	leukocyte activation
GO:0001819	0.896	positive regulation of cytokine production
GO:0046649	0.880	lymphocyte activation
GO:0098542	0.810	defense response to other organism
GO:0006955	0.789	immune response
GO:0048519	0.541	negative regulation of biological process
GO:0002252	0.540	immune effector process
GO:0048523	0.506	negative regulation of cellular process
GO:0007166	0.492	cell surface receptor signaling pathway
GO:0030101	0.478	natural killer cell activation
GO:0031323	0.398	regulation of cellular metabolic process
GO:0051171	0.381	regulation of nitrogen compound metabolic process
GO:0051249	0.329	regulation of lymphocyte activation
GO:0042221	0.313	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0009986	0.817	cell surface
GO:0005622	0.495	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]