StarFunc result for job id P26842

User Input

>input (260 residues)
MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAA
QCDPCIPGVSFSPDHHTRPHCESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTEC
DPLPNPSLTARSSQALSPHPQPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPP
QRSLCSSDFIRILVIFSGMFLVFTLAGALFLHQRRKYRSNKGESPVEPAEPCHYSCPREE
EGSTIPIQEDYRKPEPACSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P26842	0.999	0.999	2.067E-44	260	1.000	1.000	P26842.pdb.gz	CD27_HUMAN CD27 antigen OS=Homo sapiens OX=9606 GN=CD27 PE=1 SV=2
2	AFDB:Q501W2	0.675	0.697	1.213E-29	251	0.662	0.685	Q501W2.pdb.gz	Q501W2_RAT CD27 molecule OS=Rattus norvegicus OX=10116 GN=Cd27 PE=2 SV=1
3	AFDB:P41272	0.551	0.570	2.088E-29	250	0.642	0.668	P41272.pdb.gz	CD27_MOUSE CD27 antigen OS=Mus musculus OX=10090 GN=Cd27 PE=2 SV=1
4	AFDB:Q9DFV0	0.340	0.211	8.990E-9	438	0.204	0.121	Q9DFV0.pdb.gz
5	AFDB:Q93038	0.326	0.211	1.077E-8	417	0.204	0.127	Q93038.pdb.gz	TNR25_HUMAN Tumor necrosis factor receptor superfamily member 25 OS=Homo sapiens OX=9606 GN=TNFRSF25 PE=1 SV=2
6	AFDB:Q9ER62	0.354	0.458	1.643E-8	198	0.131	0.172	Q9ER62.pdb.gz	TNR22_MOUSE Tumor necrosis factor receptor superfamily member 22 OS=Mus musculus OX=10090 GN=Tnfrsf22 PE=2 SV=3
7	AFDB:Q9ER63	0.348	0.502	2.359E-8	176	0.138	0.205	Q9ER63.pdb.gz	TNR23_MOUSE Tumor necrosis factor receptor superfamily member 23 OS=Mus musculus OX=10090 GN=Tnfrsf23 PE=2 SV=2
8	AFDB:A3KPR7	0.341	0.253	4.059E-8	357	0.212	0.154	A3KPR7.pdb.gz
9	AFDB:P25446	0.355	0.285	7.878E-8	327	0.181	0.144	P25446.pdb.gz	TNR6_MOUSE Tumor necrosis factor receptor superfamily member 6 OS=Mus musculus OX=10090 GN=Fas PE=1 SV=2
10	AFDB:P27512	0.349	0.316	1.832E-7	289	0.231	0.208	P27512.pdb.gz	TNR5_MOUSE Tumor necrosis factor receptor superfamily member 5 OS=Mus musculus OX=10090 GN=Cd40 PE=1 SV=3
11	PDB:7dtvA	0.161	0.064	3.490	779	0.046	0.015	7dtvA.pdb.gz	Structural mechanism of cooperative activation of the human calcium-sensing receptor by Ca 2+ ions and L-tryptophan.
12	PDB:7q3nU	0.119	0.111	4.182	292	0.062	0.055	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
13	PDB:1haqA	0.098	0.032	5.323	1213	0.042	0.009	1haqA.pdb.gz
14	PDB:7e9hR	0.158	0.062	5.323	766	0.046	0.016	7e9hR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
15	PDB:7wihA	0.134	0.057	7.643	741	0.038	0.013	7wihA.pdb.gz	Structural basis of the activation of metabotropic glutamate receptor 3.
16	PDB:2bh2A	0.072	0.050	8.118	418	0.031	0.019	2bh2A.pdb.gz	A Unique RNA Fold in the Ruma-RNA-Cofactor Ternary Complex Contributes to Substrate Selectivity and Enzymatic Function
17	PDB:6n8mY	0.078	0.142	8.622	128	0.023	0.047	6n8mY.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
18	PDB:5jeaI	0.062	0.066	9.727	235	0.027	0.030	5jeaI.pdb.gz	Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
19	PDB:7wtbB	0.082	0.030	9.727	1147	0.050	0.011	7wtbB.pdb.gz	Mechanistic insight into allosteric activation of human pyruvate carboxylase by acetyl-CoA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P26842	0.0	535	260	1.000	1.000	CD27_HUMAN CD27 antigen OS=Homo sapiens OX=9606 GN=CD27 PE=1 SV=2
2	Q501W2	1.13e-115	333	251	0.662	0.685	Q501W2_RAT CD27 molecule OS=Rattus norvegicus OX=10116 GN=Cd27 PE=2 SV=1
3	P41272	1.47e-115	333	250	0.646	0.672	CD27_MOUSE CD27 antigen OS=Mus musculus OX=10090 GN=Cd27 PE=2 SV=1
4	F7FDI3	8.73e-45	151	190	0.269	0.368	F7FDI3_RAT CD27 molecule OS=Rattus norvegicus OX=10116 GN=Cd27 PE=4 SV=1
5	A0A8I5Y9T6	1.01e-30	113	146	0.231	0.411	A0A8I5Y9T6_RAT CD27 molecule OS=Rattus norvegicus OX=10116 GN=Cd27 PE=4 SV=1
6	A0A8A1UEA0	1.05e-13	65.9	52	0.127	0.635	A0A8A1UEA0_RAT CD27 molecule (Fragment) OS=Rattus norvegicus OX=10116 GN=Cd27 PE=4 SV=1
7	F6SVZ3	3.79e-09	58.2	269	0.235	0.227	F6SVZ3_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
8	P15725	3.81e-09	58.2	271	0.200	0.192	TNR4_RAT Tumor necrosis factor receptor superfamily member 4 OS=Rattus norvegicus OX=10116 GN=Tnfrsf4 PE=2 SV=1
9	Q63199	3.83e-09	58.5	324	0.138	0.111	TNR6_RAT Tumor necrosis factor receptor superfamily member 6 OS=Rattus norvegicus OX=10116 GN=Fas PE=1 SV=1
10	A0A8I6AHI1	4.18e-09	58.2	309	0.231	0.194	A0A8I6AHI1_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
11	P25942	9.20e-09	57.0	277	0.250	0.235	TNR5_HUMAN Tumor necrosis factor receptor superfamily member 5 OS=Homo sapiens OX=9606 GN=CD40 PE=1 SV=1
12	P25446	2.43e-08	56.2	327	0.135	0.107	TNR6_MOUSE Tumor necrosis factor receptor superfamily member 6 OS=Mus musculus OX=10090 GN=Fas PE=1 SV=2
13	A0A8I6A4J5	7.22e-08	54.3	260	0.165	0.165	A0A8I6A4J5_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
14	P27512	9.33e-08	54.3	289	0.200	0.180	TNR5_MOUSE Tumor necrosis factor receptor superfamily member 5 OS=Mus musculus OX=10090 GN=Cd40 PE=1 SV=3
15	A0A8I5XVD8	1.44e-07	52.8	204	0.165	0.211	A0A8I5XVD8_RAT CD40 molecule OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
16	P47741	4.60e-07	52.0	272	0.142	0.136	TNR4_MOUSE Tumor necrosis factor receptor superfamily member 4 OS=Mus musculus OX=10090 GN=Tnfrsf4 PE=1 SV=1
17	Q0PKX6	7.65e-07	52.0	436	0.219	0.131	Q0PKX6_DANRE Ovarian TNF receptor OS=Danio rerio OX=7955 GN=otr PE=2 SV=1
18	K9J972	4.04e-06	48.5	197	0.119	0.157	K9J972_HUMAN FAS receptor variant 9 OS=Homo sapiens OX=9606 GN=FAS PE=1 SV=1
19	Q9ER62	4.28e-06	48.5	198	0.104	0.136	TNR22_MOUSE Tumor necrosis factor receptor superfamily member 22 OS=Mus musculus OX=10090 GN=Tnfrsf22 PE=2 SV=3
20	P25445	4.41e-06	49.3	335	0.119	0.093	TNR6_HUMAN Tumor necrosis factor receptor superfamily member 6 OS=Homo sapiens OX=9606 GN=FAS PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06365 CD34_antigen	5e+02	11.7	CD34/Podocalyxin family
2	PF00020 TNFR_c6	0.00081	31.1	TNFR/NGFR cysteine-rich region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000266557

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245903	0.999	CD70 antigen
2	9606.ENSP00000329213	0.979	Apoptosis regulatory protein Siva
3	9606.ENSP00000246657	0.899	C-C chemokine receptor type 7
4	9606.ENSP00000437940	0.897	B-lymphocyte antigen CD19
5	9606.ENSP00000226279	0.881	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
6	9606.ENSP00000386559	0.880	T-cell surface glycoprotein CD8 alpha chain
7	9606.ENSP00000011653	0.878	T-cell surface glycoprotein CD4
8	9606.ENSP00000324890	0.872	T-cell-specific surface glycoprotein CD28
9	9606.ENSP00000303939	0.865	Cytotoxic T-lymphocyte protein 4
10	9606.ENSP00000247668	0.855	TNF receptor-associated factor 2
11	9606.ENSP00000236147	0.850	L-selectin
12	9606.ENSP00000358490	0.845	T-cell surface antigen CD2
13	9606.ENSP00000306157	0.828	Interleukin-7 receptor subunit alpha
14	9606.ENSP00000356024	0.808	Complement receptor type 2
15	9606.ENSP00000454207	0.804	TNF receptor-associated factor 3
16	9606.ENSP00000398698	0.803	Tumor necrosis factor
17	9606.ENSP00000433847	0.801	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1
18	9606.ENSP00000226730	0.800	Interleukin-2
19	9606.ENSP00000368538	0.794	Tumor necrosis factor receptor superfamily member 4
20	9606.ENSP00000228434	0.792	Early activation antigen CD69

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0038023	0.811	signaling receptor activity
GO:0061134	0.767	peptidase regulator activity
GO:0043028	0.760	cysteine-type endopeptidase regulator activity involved in apoptotic process
GO:0030414	0.748	peptidase inhibitor activity
GO:0061135	0.747	endopeptidase regulator activity
GO:0004869	0.726	cysteine-type endopeptidase inhibitor activity
GO:0043027	0.681	cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0004888	0.426	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0048523	0.978	negative regulation of cellular process
GO:0007165	0.977	signal transduction
GO:0010941	0.972	regulation of cell death
GO:0043067	0.922	regulation of programmed cell death
GO:0006915	0.823	apoptotic process
GO:0042981	0.805	regulation of apoptotic process
GO:0007166	0.792	cell surface receptor signaling pathway
GO:0048518	0.574	positive regulation of biological process
GO:0048522	0.453	positive regulation of cellular process
GO:0060548	0.385	negative regulation of cell death
GO:0097190	0.370	apoptotic signaling pathway
GO:0043066	0.358	negative regulation of apoptotic process
GO:0048583	0.338	regulation of response to stimulus
GO:0042221	0.316	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043231	0.395	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]