StarFunc result for job id P26927

User Input

>input (711 residues)
MGWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRC
GPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDLFQKKDYVRTCIMNNGVGYRG
TMATTVGGLPCQAWSHKFPNDHKYTPTLRNGLEENFCRNPDGDPGGPWCYTTDPAVRFQS
CGIKSCREAACVWCNGEEYRGAVDRTESGRECQRWDLQHPHQHPFEPGKFLDQGLDDNYC
RNPDGSERPWCYTTDPQIEREFCDLPRCGSEAQPRQEATTVSCFRGKGEGYRGTANTTTA
GVPCQRWDAQIPHQHRFTPEKYACKDLRENFCRNPDGSEAPWCFTLRPGMRAAFCYQIRR
CTDDVRPQDCYHGAGEQYRGTVSKTRKGVQCQRWSAETPHKPQFTFTSEPHAQLEENFCR
NPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPPSILDPPDQVQFEKCGKRVDRLDQRRS
KLRVVGGHPGNSPWTVSLRNRQGQHFCGGSLVKEQWILTARQCFSSCHMPLTGYEVWLGT
LFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLERSVTLNQRVALICLPPEWYVVPPGT
KCEIAGWGETKGTGNDTVLNVALLNVISNQECNIKHRGRVRESEMCTEGLLAPVGACEGD
YGGPLACFTHNCWVLEGIIIPNRVCARSRWPAVFTRVSVFVDWIHKVMRLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F7FMS0	0.638	0.618	0.000	739	0.803	0.773	F7FMS0.pdb.gz	F7FMS0_RAT Macrophage stimulating 1 OS=Rattus norvegicus OX=10116 GN=Mst1 PE=4 SV=1
2	AFDB:P26927	1.000	1.000	0.000	711	1.000	1.000	P26927.pdb.gz	HGFL_HUMAN Hepatocyte growth factor-like protein OS=Homo sapiens OX=9606 GN=MST1 PE=1 SV=2
3	AFDB:P26928	0.637	0.633	0.000	716	0.803	0.797	P26928.pdb.gz	HGFL_MOUSE Hepatocyte growth factor-like protein OS=Mus musculus OX=10090 GN=Mst1 PE=2 SV=2
4	AFDB:Q5XFY1	0.759	0.760	0.000	709	0.565	0.567	Q5XFY1.pdb.gz
5	AFDB:A0A1D5PAR6	0.721	0.708	6.501E-86	726	0.444	0.435	A0A1D5PAR6.pdb.gz
6	AFDB:P14210	0.481	0.471	6.986E-83	728	0.428	0.418	P14210.pdb.gz	HGF_HUMAN Hepatocyte growth factor OS=Homo sapiens OX=9606 GN=HGF PE=1 SV=2
7	AFDB:A4IGA7	0.476	0.475	1.444E-82	712	0.421	0.420	A4IGA7.pdb.gz
8	AFDB:F6PA78	0.480	0.497	8.044E-81	685	0.408	0.423	F6PA78.pdb.gz
9	AFDB:P00747	0.314	0.276	7.961E-76	810	0.429	0.377	P00747.pdb.gz	PLMN_HUMAN Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=2
10	AFDB:P20918	0.325	0.295	2.472E-72	812	0.421	0.368	P20918.pdb.gz	PLMN_MOUSE Plasminogen OS=Mus musculus OX=10090 GN=Plg PE=1 SV=3
11	PDB:4a5tS	0.310	0.292	4.595E-68	767	0.422	0.391	4a5tS.pdb.gz
12	PDB:4duuA	0.318	0.331	8.862E-67	682	0.411	0.428	4duuA.pdb.gz
13	PDB:5edmA	0.394	0.499	1.152E-31	550	0.194	0.251	5edmA.pdb.gz	How the Linker Connecting the Two Kringles Influences Activation and Conformational Plasticity of Prothrombin.
14	PDB:6bjrA	0.379	0.455	1.242E-24	575	0.187	0.231	6bjrA.pdb.gz	Structure of prothrombin in the closed form reveals new details on the mechanism of activation.
15	PDB:1cgiE	0.293	0.820	1.669E-21	245	0.105	0.306	1cgiE.pdb.gz
16	PDB:1a0lA	0.290	0.813	7.968E-21	244	0.108	0.316	1a0lA.pdb.gz	Human beta-tryptase is a ring-like tetramer with active sites facing a central pore.
17	PDB:2a7jA	0.295	0.841	3.043E-20	240	0.117	0.346	2a7jA.pdb.gz	On the routine use of soft X-rays in macromolecular crystallography. Part III. The optimal data-collection wavelength.
18	PDB:4h4fA	0.292	0.827	5.625E-20	239	0.104	0.310	4h4fA.pdb.gz	Long-range Electrostatic Complementarity Governs Substrate Recognition by Human Chymotrypsin C, a Key Regulator of Digestive Enzyme Activation.
19	PDB:4bnrA	0.294	0.850	7.032E-20	237	0.098	0.295	4bnrA.pdb.gz	Comparison of Complexes Formed by a Crustacean and a Vertebrate Trypsin with Bovine Pancreatic Trypsin Inhibitor - the Key to Achieving Extreme Stability?
20	PDB:1fujA	0.278	0.853	1.374E-19	221	0.103	0.330	1fujA.pdb.gz	The crystal structure of PR3, a neutrophil serine proteinase antigen of Wegener's granulomatosis antibodies.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1REK1	0.0	575	712	0.432	0.431	F1REK1_DANRE Hepatocyte growth factor OS=Danio rerio OX=7955 GN=hgf1 PE=3 SV=1
2	F7FMS0	0.0	1169	739	0.805	0.774	F7FMS0_RAT Macrophage stimulating 1 OS=Rattus norvegicus OX=10116 GN=Mst1 PE=4 SV=1
3	P14210	0.0	600	728	0.433	0.423	HGF_HUMAN Hepatocyte growth factor OS=Homo sapiens OX=9606 GN=HGF PE=1 SV=2
4	P17945	0.0	601	728	0.425	0.415	HGF_RAT Hepatocyte growth factor OS=Rattus norvegicus OX=10116 GN=Hgf PE=1 SV=1
5	P26927	0.0	1472	711	1.000	1.000	HGFL_HUMAN Hepatocyte growth factor-like protein OS=Homo sapiens OX=9606 GN=MST1 PE=1 SV=2
6	P26928	0.0	1181	716	0.805	0.799	HGFL_MOUSE Hepatocyte growth factor-like protein OS=Mus musculus OX=10090 GN=Mst1 PE=2 SV=2
7	P70521	0.0	1177	716	0.805	0.799	P70521_RAT Macrophage stimulating 1 (Hepatocyte growth factor-like) OS=Rattus norvegicus OX=10116 GN=Mst1 PE=2 SV=1
8	Q08048	0.0	602	728	0.425	0.415	HGF_MOUSE Hepatocyte growth factor OS=Mus musculus OX=10090 GN=Hgf PE=1 SV=1
9	Q5RGG3	0.0	571	699	0.426	0.433	Q5RGG3_DANRE Hepatocyte growth factor OS=Danio rerio OX=7955 GN=hgf1 PE=3 SV=1
10	Q90978	0.0	593	726	0.442	0.433	Q90978_CHICK Hepatocyte growth factor OS=Gallus gallus OX=9031 GN=HGF PE=2 SV=3
11	Q90ZN6	0.0	842	709	0.567	0.568	Q90ZN6_DANRE Hepatocyte growth factor-like 1 OS=Danio rerio OX=7955 GN=hgfl1 PE=2 SV=1
12	P06868	3.83e-153	466	812	0.367	0.321	PLMN_BOVIN Plasminogen OS=Bos taurus OX=9913 GN=PLG PE=1 SV=2
13	P20918	2.66e-152	464	812	0.367	0.321	PLMN_MOUSE Plasminogen OS=Mus musculus OX=10090 GN=Plg PE=1 SV=3
14	Q01177	4.91e-152	463	812	0.364	0.319	PLMN_RAT Plasminogen OS=Rattus norvegicus OX=10116 GN=Plg PE=2 SV=2
15	P00747	9.58e-143	439	810	0.367	0.322	PLMN_HUMAN Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=2
16	P08519	3.50e-132	432	2040	0.361	0.126	APOA_HUMAN Apolipoprotein(a) OS=Homo sapiens OX=9606 GN=LPA PE=1 SV=2
17	Q788Q2	2.77e-122	372	405	0.259	0.454	Q788Q2_CHICK HGF protein ( SFprotein ) (Fragment) OS=Gallus gallus OX=9031 GN=HGF PE=2 SV=1
18	P00735	2.66e-46	176	625	0.219	0.250	THRB_BOVIN Prothrombin OS=Bos taurus OX=9913 GN=F2 PE=1 SV=2
19	P00750	8.50e-42	162	562	0.190	0.240	TPA_HUMAN Tissue-type plasminogen activator OS=Homo sapiens OX=9606 GN=PLAT PE=1 SV=1
20	P00734	1.48e-41	162	622	0.200	0.228	THRB_HUMAN Prothrombin OS=Homo sapiens OX=9606 GN=F2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09342 DUF1986	77	15.1	Domain of unknown function (DUF1986)
2	PF00051 Kringle	4.7e-109	368.2	Kringle domain
3	PF00024 PAN_1	8.4e-10	49.8	PAN domain
4	PF14295 PAN_4	2.5e+02	13.0	PAN domain
5	PF00089 Trypsin	1.7e-43	160.6	Trypsin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000414287

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296474	0.999	Macrophage-stimulating protein receptor
2	9606.ENSP00000342098	0.938	Kunitz-type protease inhibitor 1
3	9606.ENSP00000451828	0.938	RAC-alpha serine/threonine-protein kinase
4	9606.ENSP00000262626	0.920	Serine protease hepsin
5	9606.ENSP00000301244	0.914	Kunitz-type protease inhibitor 2
6	9606.ENSP00000385824	0.913	Forkhead box protein O3
7	9606.ENSP00000441691	0.909	Integrin alpha-M
8	9606.ENSP00000264832	0.907	Intercellular adhesion molecule 1
9	9606.ENSP00000380948	0.903	Integrin beta-2
10	9606.ENSP00000264335	0.901	14-3-3 protein epsilon
11	9606.ENSP00000361930	0.901	14-3-3 protein beta/alpha
12	9606.ENSP00000248975	0.900	14-3-3 protein eta
13	9606.ENSP00000306330	0.900	14-3-3 protein gamma
14	9606.ENSP00000340989	0.900	14-3-3 protein sigma
15	9606.ENSP00000371267	0.900	14-3-3 protein theta
16	9606.ENSP00000379287	0.900	14-3-3 protein zeta/delta
17	9606.ENSP00000296456	0.830	Acylamino-acid-releasing enzyme
18	9606.ENSP00000350467	0.642	GCN5 related N-acetyltransferases
19	9606.ENSP00000317272	0.608	Hepatocyte growth factor receptor
20	9606.ENSP00000258962	0.603	Serine/arginine-rich splicing factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140096	1.000	catalytic activity, acting on a protein
GO:0005102	0.999	signaling receptor binding
GO:0019901	0.999	protein kinase binding
GO:0016787	0.998	hydrolase activity
GO:1990782	0.993	protein tyrosine kinase binding
GO:0008233	0.967	peptidase activity
GO:0008236	0.956	serine-type peptidase activity
GO:0030971	0.903	receptor tyrosine kinase binding
GO:0004672	0.735	protein kinase activity
GO:0035173	0.712	histone kinase activity
GO:0042802	0.654	identical protein binding
GO:0004175	0.619	endopeptidase activity
GO:0004252	0.507	serine-type endopeptidase activity
GO:0098772	0.327	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0051171	0.979	regulation of nitrogen compound metabolic process
GO:0080090	0.971	regulation of primary metabolic process
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0009987	0.957	cellular process
GO:0048519	0.955	negative regulation of biological process
GO:0048523	0.945	negative regulation of cellular process
GO:0050896	0.876	response to stimulus
GO:0051246	0.849	regulation of protein metabolic process
GO:0048518	0.833	positive regulation of biological process
GO:0071704	0.826	organic substance metabolic process
GO:0031323	0.812	regulation of cellular metabolic process
GO:0043067	0.807	regulation of programmed cell death
GO:0042981	0.804	regulation of apoptotic process
GO:0065009	0.803	regulation of molecular function
GO:0050790	0.784	regulation of catalytic activity
GO:0051716	0.782	cellular response to stimulus
GO:0006807	0.768	nitrogen compound metabolic process
GO:0031324	0.764	negative regulation of cellular metabolic process
GO:0048522	0.756	positive regulation of cellular process
GO:0044238	0.753	primary metabolic process
GO:1901564	0.748	organonitrogen compound metabolic process
GO:0019220	0.745	regulation of phosphate metabolic process
GO:0032501	0.733	multicellular organismal process
GO:0001932	0.728	regulation of protein phosphorylation
GO:0032502	0.718	developmental process
GO:0009889	0.677	regulation of biosynthetic process
GO:0051338	0.673	regulation of transferase activity
GO:0043170	0.662	macromolecule metabolic process
GO:0009893	0.627	positive regulation of metabolic process
GO:0048856	0.570	anatomical structure development
GO:0010605	0.548	negative regulation of macromolecule metabolic process
GO:0010604	0.538	positive regulation of macromolecule metabolic process
GO:0051172	0.507	negative regulation of nitrogen compound metabolic process
GO:0006109	0.480	regulation of carbohydrate metabolic process
GO:0031326	0.467	regulation of cellular biosynthetic process
GO:0048583	0.463	regulation of response to stimulus
GO:0010468	0.453	regulation of gene expression
GO:0031325	0.446	positive regulation of cellular metabolic process
GO:0051173	0.431	positive regulation of nitrogen compound metabolic process
GO:0019538	0.421	protein metabolic process
GO:0023051	0.415	regulation of signaling
GO:0010646	0.381	regulation of cell communication
GO:0009966	0.371	regulation of signal transduction
GO:0051239	0.367	regulation of multicellular organismal process
GO:0007275	0.359	multicellular organism development
GO:0062012	0.332	regulation of small molecule metabolic process
GO:0043549	0.324	regulation of kinase activity
GO:0045859	0.313	regulation of protein kinase activity
GO:0042221	0.312	response to chemical
GO:0043069	0.309	negative regulation of programmed cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005737	0.992	cytoplasm
GO:0005576	0.965	extracellular region
GO:0071944	0.959	cell periphery
GO:0043227	0.955	membrane-bounded organelle
GO:0031982	0.906	vesicle
GO:0043231	0.891	intracellular membrane-bounded organelle
GO:0016020	0.886	membrane
GO:1903561	0.879	extracellular vesicle
GO:0005615	0.874	extracellular space
GO:0070062	0.858	extracellular exosome
GO:0005829	0.521	cytosol
GO:0030312	0.508	external encapsulating structure
GO:0031012	0.465	extracellular matrix
GO:0005886	0.404	plasma membrane
GO:0062023	0.401	collagen-containing extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.998	Hydrolases.
EC:3.4.-.-	0.967	Acting on peptide bonds (peptidases).
EC:2.7.1.-	0.735	Phosphotransferases with an alcohol group as acceptor.
EC:3.4.21.-	0.507	Serine endopeptidases.

[back to server]