StarFunc result for job id P26992

User Input

>input (372 residues)
MAAPVPWACCAVLAAAAAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVN
GTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNT
YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPFLVSVPITLAL
AAAAATASSLLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88507	0.789	0.789	2.920E-64	372	0.952	0.952	O88507.pdb.gz	CNTFR_MOUSE Ciliary neurotrophic factor receptor subunit alpha OS=Mus musculus OX=10090 GN=Cntfr PE=1 SV=2
2	AFDB:A4JYQ0	0.768	0.799	4.053E-44	357	0.508	0.529	A4JYQ0.pdb.gz	A4JYQ0_DANRE Ciliary neurotrophic factor receptor OS=Danio rerio OX=7955 GN=cb549 PE=2 SV=1
3	AFDB:Q14626	0.498	0.447	7.027E-27	422	0.266	0.235	Q14626.pdb.gz	I11RA_HUMAN Interleukin-11 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL11RA PE=1 SV=2
4	AFDB:Q64385	0.496	0.438	3.196E-26	432	0.272	0.234	Q64385.pdb.gz	I11RA_MOUSE Interleukin-11 receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Il11ra1 PE=1 SV=1
5	AFDB:P08887	0.554	0.455	8.621E-26	468	0.277	0.220	P08887.pdb.gz	IL6RA_HUMAN Interleukin-6 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL6R PE=1 SV=1
6	AFDB:P22272	0.533	0.449	1.303E-24	460	0.269	0.217	P22272.pdb.gz	IL6RA_MOUSE Interleukin-6 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il6ra PE=1 SV=2
7	AFDB:Q9JM58	0.593	0.528	1.845E-20	425	0.215	0.188	Q9JM58.pdb.gz	CRLF1_MOUSE Cytokine receptor-like factor 1 OS=Mus musculus OX=10090 GN=Crlf1 PE=1 SV=1
8	AFDB:P40190	0.483	0.229	2.790E-19	918	0.169	0.069	P40190.pdb.gz	IL6RB_RAT Interleukin-6 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Il6st PE=1 SV=1
9	AFDB:P40189	0.460	0.222	4.955E-19	918	0.175	0.071	P40189.pdb.gz	IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2
10	AFDB:P46282	0.418	0.472	1.143E-18	327	0.180	0.205	P46282.pdb.gz	IL12B_BOVIN Interleukin-12 subunit beta OS=Bos taurus OX=9913 GN=IL12B PE=2 SV=1
11	PDB:5mj3A	0.406	0.493	2.147E-17	302	0.172	0.212	5mj3A.pdb.gz
12	PDB:7u7nC	0.489	0.889	1.734E-16	200	0.167	0.310	7u7nC.pdb.gz
13	PDB:7z0lB	0.410	0.412	1.395E-14	370	0.167	0.168	7z0lB.pdb.gz
14	PDB:5oj2B	0.358	0.225	1.595E-9	692	0.132	0.071	5oj2B.pdb.gz
15	PDB:6pxvA	0.225	0.113	1.156E-7	823	0.113	0.051	6pxvA.pdb.gz
16	PDB:1e07A	0.246	0.160	3.842E-7	642	0.110	0.064	1e07A.pdb.gz
17	PDB:8dtlA	0.216	0.121	5.538E-7	741	0.116	0.058	8dtlA.pdb.gz
18	PDB:8eyyA	0.237	0.122	9.336E-7	775	0.116	0.055	8eyyA.pdb.gz
19	PDB:6dldD	0.285	0.371	2.946E-6	269	0.105	0.145	6dldD.pdb.gz
20	PDB:6pyhD	0.226	0.121	3.270E-6	798	0.132	0.061	6pyhD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88507	0.0	668	372	0.917	0.917	CNTFR_MOUSE Ciliary neurotrophic factor receptor subunit alpha OS=Mus musculus OX=10090 GN=Cntfr PE=1 SV=2
2	P26992	0.0	764	372	1.000	1.000	CNTFR_HUMAN Ciliary neurotrophic factor receptor subunit alpha OS=Homo sapiens OX=9606 GN=CNTFR PE=1 SV=2
3	Q08406	0.0	663	372	0.906	0.906	CNTFR_RAT Ciliary neurotrophic factor receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Cntfr PE=2 SV=2
4	A4JYQ0	5.40e-129	376	357	0.503	0.524	A4JYQ0_DANRE Ciliary neurotrophic factor receptor OS=Danio rerio OX=7955 GN=cb549 PE=2 SV=1
5	Q14626	1.68e-36	139	422	0.282	0.249	I11RA_HUMAN Interleukin-11 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL11RA PE=1 SV=2
6	P22273	8.84e-35	135	462	0.250	0.201	IL6RA_RAT Interleukin-6 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il6r PE=2 SV=2
7	P22272	4.23e-34	133	460	0.296	0.239	IL6RA_MOUSE Interleukin-6 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il6ra PE=1 SV=2
8	Q99MF4	2.29e-33	130	431	0.285	0.246	I11RA_RAT Interleukin-11 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il11ra1 PE=2 SV=1
9	Q64385	2.30e-33	130	432	0.282	0.243	I11RA_MOUSE Interleukin-11 receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Il11ra1 PE=1 SV=1
10	Q14213	8.27e-24	100	229	0.164	0.266	IL27B_HUMAN Interleukin-27 subunit beta OS=Homo sapiens OX=9606 GN=EBI3 PE=1 SV=2
11	P08887	2.78e-22	100	468	0.210	0.167	IL6RA_HUMAN Interleukin-6 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL6R PE=1 SV=1
12	O35228	6.23e-20	89.7	228	0.169	0.276	IL27B_MOUSE Interleukin-27 subunit beta OS=Mus musculus OX=10090 GN=Ebi3 PE=1 SV=1
13	W5PUF3	5.56e-13	71.2	324	0.199	0.228	W5PUF3_SHEEP Interleukin-12 subunit beta OS=Ovis aries OX=9940 GN=IL12B PE=3 SV=1
14	O75462	1.31e-12	70.9	422	0.212	0.187	CRLF1_HUMAN Cytokine receptor-like factor 1 OS=Homo sapiens OX=9606 GN=CRLF1 PE=1 SV=1
15	P68220	1.43e-12	70.1	327	0.199	0.226	IL12B_SHEEP Interleukin-12 subunit beta OS=Ovis aries OX=9940 GN=IL12B PE=1 SV=1
16	P46282	2.12e-12	69.7	327	0.202	0.229	IL12B_BOVIN Interleukin-12 subunit beta OS=Bos taurus OX=9913 GN=IL12B PE=2 SV=1
17	Q04594	5.86e-12	69.3	831	0.156	0.070	PRLR_CHICK Prolactin receptor OS=Gallus gallus OX=9031 GN=PRLR PE=2 SV=1
18	Q9JM58	6.34e-11	65.9	425	0.207	0.181	CRLF1_MOUSE Cytokine receptor-like factor 1 OS=Mus musculus OX=10090 GN=Crlf1 PE=1 SV=1
19	Q17RA0	1.04e-10	65.9	918	0.151	0.061	Q17RA0_HUMAN Interleukin 6 signal transducer (Gp130, oncostatin M receptor) OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=1
20	P40189	1.69e-10	65.1	918	0.151	0.061	IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	0.00082	31.0	Fibronectin type III domain
2	PF13895 Ig_2	31	16.3	Immunoglobulin domain
3	PF13927 Ig_3	0.61	22.0	Immunoglobulin domain
4	PF16681 Ig_5	48	15.8	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
5	PF16666 MAGI_u5	6.5e+02	12.2	Unstructured region on MAGI

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368265

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355370	0.999	Ciliary neurotrophic factor
2	9606.ENSP00000263409	0.998	Leukemia inhibitory factor receptor
3	9606.ENSP00000309338	0.985	Cardiotrophin-like cytokine factor 1
4	9606.ENSP00000263379	0.953	Interleukin-27 receptor subunit alpha
5	9606.ENSP00000370698	0.917	Interleukin-6 receptor subunit beta
6	9606.ENSP00000376188	0.902	Cytokine receptor-like factor 1
7	9606.ENSP00000249075	0.862	Leukemia inhibitory factor
8	9606.ENSP00000279804	0.833	Cardiotrophin-1
9	9606.ENSP00000357470	0.796	Interleukin-6 receptor subunit alpha
10	9606.ENSP00000385675	0.774	Interleukin-6
11	9606.ENSP00000215781	0.773	Oncostatin-M
12	9606.ENSP00000264563	0.772	Interleukin-11
13	9606.ENSP00000312652	0.748	Leptin
14	9606.ENSP00000368856	0.721	Transcriptional repressor NF-X1
15	9606.ENSP00000371067	0.709	Tyrosine-protein kinase JAK2
16	9606.ENSP00000368455	0.674	Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
17	9606.ENSP00000302924	0.663	Interleukin-17D
18	9606.ENSP00000431885	0.658	Non-receptor tyrosine-protein kinase TYK2
19	9606.ENSP00000343204	0.657	Tyrosine-protein kinase JAK1
20	9606.ENSP00000231228	0.652	Interleukin-12 subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004896	1.000	cytokine receptor activity
GO:0019955	0.994	cytokine binding
GO:0004897	0.661	ciliary neurotrophic factor receptor activity
GO:0005102	0.625	signaling receptor binding
GO:0005126	0.361	cytokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0050794	0.996	regulation of cellular process
GO:0010941	0.994	regulation of cell death
GO:0007154	0.986	cell communication
GO:0051716	0.986	cellular response to stimulus
GO:0023052	0.985	signaling
GO:0043524	0.980	negative regulation of neuron apoptotic process
GO:0007165	0.972	signal transduction
GO:0019221	0.949	cytokine-mediated signaling pathway
GO:0032501	0.943	multicellular organismal process
GO:0032502	0.935	developmental process
GO:0048518	0.935	positive regulation of biological process
GO:0048856	0.934	anatomical structure development
GO:0048522	0.929	positive regulation of cellular process
GO:0042127	0.439	regulation of cell population proliferation
GO:0008284	0.398	positive regulation of cell population proliferation
GO:0007275	0.374	multicellular organism development
GO:0019222	0.347	regulation of metabolic process
GO:0060255	0.341	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005886	1.000	plasma membrane
GO:0032991	0.999	protein-containing complex
GO:0098796	0.781	membrane protein complex
GO:0043235	0.738	receptor complex
GO:0098797	0.720	plasma membrane protein complex
GO:0045177	0.642	apical part of cell
GO:0005615	0.569	extracellular space
GO:0098590	0.569	plasma membrane region
GO:0098802	0.538	plasma membrane signaling receptor complex
GO:0005622	0.457	intracellular anatomical structure
GO:0019898	0.346	extrinsic component of membrane
GO:0016324	0.303	apical plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]