StarFunc result for job id P27037

User Input

>input (513 residues)
MGAAAKLAFAVFLISCSSGAILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHC
FATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEM
EVTQPTSNPVTPKPPYYNILLYSLVPLMLIAGIVICAFWVYRHHKMAYPPVLVPTQDPGP
PPPSPLLGLKPLQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPG
MKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGL
AYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQV
GTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIG
QHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERIT
QMQRLTNIITTEDIVTVVTMVTNVDFPPKESSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P27037	1.000	1.000	2.424E-102	513	1.000	1.000	P27037.pdb.gz	AVR2A_HUMAN Activin receptor type-2A OS=Homo sapiens OX=9606 GN=ACVR2A PE=1 SV=1
2	AFDB:A9CAY0	0.638	0.636	8.290E-84	514	0.789	0.788	A9CAY0.pdb.gz
3	AFDB:F1R4D0	0.615	0.587	6.602E-83	538	0.789	0.753	F1R4D0.pdb.gz
4	AFDB:F1NCI7	0.647	0.648	3.132E-78	512	0.682	0.684	F1NCI7.pdb.gz
5	AFDB:P27040	0.631	0.604	9.090E-78	536	0.667	0.638	P27040.pdb.gz	AVR2B_MOUSE Activin receptor type-2B OS=Mus musculus OX=10090 GN=Acvr2b PE=1 SV=1
6	AFDB:P38445	0.624	0.624	1.993E-77	513	0.661	0.661	P38445.pdb.gz	AVR2B_RAT Activin receptor type-2B OS=Rattus norvegicus OX=10116 GN=Acvr2b PE=1 SV=3
7	AFDB:F1QLL7	0.726	0.731	6.037E-73	509	0.624	0.629	F1QLL7.pdb.gz
8	AFDB:Q24229	0.585	0.582	3.278E-58	516	0.466	0.463	Q24229.pdb.gz	Q24229_DROME Serine/threonine-protein kinase receptor OS=Drosophila melanogaster OX=7227 GN=put PE=2 SV=1
9	AFDB:B0V0H4	0.566	0.275	9.170E-47	1071	0.353	0.169	B0V0H4.pdb.gz
10	AFDB:O42124	0.566	0.287	3.331E-46	1031	0.337	0.168	O42124.pdb.gz	O42124_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BRK-3 PE=2 SV=1
11	PDB:8dksA	0.403	0.709	2.876E-17	283	0.162	0.293	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
12	PDB:4krcA	0.414	0.687	1.041E-15	297	0.133	0.229	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
13	PDB:4rerA	0.416	0.462	3.022E-15	459	0.115	0.129	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
14	PDB:2qkwB	0.398	0.673	4.000E-15	292	0.152	0.267	2qkwB.pdb.gz
15	PDB:5u6yA	0.426	0.473	1.719E-14	459	0.121	0.135	5u6yA.pdb.gz
16	PDB:1k9aB	0.414	0.478	2.034E-14	441	0.133	0.154	1k9aB.pdb.gz
17	PDB:4zhxA	0.428	0.529	2.275E-14	409	0.115	0.144	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
18	PDB:5ufuA	0.426	0.579	2.275E-14	369	0.117	0.163	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
19	PDB:3c4wB	0.420	0.415	2.406E-14	519	0.138	0.137	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
20	PDB:6b1uA	0.421	0.484	3.012E-14	442	0.119	0.138	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QG01	0.0	870	514	0.799	0.798	F1QG01_DANRE Serine/threonine-protein kinase receptor OS=Danio rerio OX=7955 GN=actr2a PE=3 SV=1
2	P27037	0.0	1077	513	1.000	1.000	AVR2A_HUMAN Activin receptor type-2A OS=Homo sapiens OX=9606 GN=ACVR2A PE=1 SV=1
3	P27038	0.0	1075	513	0.996	0.996	AVR2A_MOUSE Activin receptor type-2A OS=Mus musculus OX=10090 GN=Acvr2a PE=1 SV=1
4	P27040	0.0	719	536	0.671	0.642	AVR2B_MOUSE Activin receptor type-2B OS=Mus musculus OX=10090 GN=Acvr2b PE=1 SV=1
5	P38444	0.0	1070	513	0.990	0.990	AVR2A_RAT Activin receptor type-2A OS=Rattus norvegicus OX=10116 GN=Acvr2a PE=1 SV=1
6	P38445	0.0	720	513	0.669	0.669	AVR2B_RAT Activin receptor type-2B OS=Rattus norvegicus OX=10116 GN=Acvr2b PE=1 SV=3
7	Q13705	0.0	729	512	0.671	0.672	AVR2B_HUMAN Activin receptor type-2B OS=Homo sapiens OX=9606 GN=ACVR2B PE=1 SV=3
8	Q66T47	0.0	726	512	0.667	0.668	AVR2B_PIG Activin receptor type-2B OS=Sus scrofa OX=9823 GN=ACVR2B PE=2 SV=1
9	Q90669	0.0	973	513	0.926	0.926	AVR2A_CHICK Activin receptor type-2A OS=Gallus gallus OX=9031 GN=ACVR2A PE=2 SV=1
10	Q90670	0.0	748	512	0.690	0.691	AVR2B_CHICK Activin receptor type-2B OS=Gallus gallus OX=9031 GN=ACVR2B PE=2 SV=1
11	Q9YGU4	0.0	709	509	0.645	0.650	Q9YGU4_DANRE Serine/threonine-protein kinase receptor OS=Danio rerio OX=7955 GN=ActrIIB PE=1 SV=1
12	Q24468	4.14e-150	441	516	0.466	0.463	Q24468_DROME Serine/threonine-protein kinase receptor OS=Drosophila melanogaster OX=7227 GN=put PE=1 SV=1
13	A0A0B4KG59	4.51e-150	441	520	0.466	0.460	A0A0B4KG59_DROME Serine/threonine-protein kinase receptor OS=Drosophila melanogaster OX=7227 GN=put PE=1 SV=1
14	Q24229	2.40e-149	439	516	0.464	0.461	Q24229_DROME Serine/threonine-protein kinase receptor OS=Drosophila melanogaster OX=7227 GN=put PE=2 SV=1
15	Q95T01	2.58e-115	343	284	0.320	0.577	Q95T01_DROME Serine/threonine-protein kinase receptor OS=Drosophila melanogaster OX=7227 GN=put PE=2 SV=1
16	Q90999	1.27e-92	295	557	0.324	0.298	TGFR2_CHICK TGF-beta receptor type-2 OS=Gallus gallus OX=9031 GN=TGFBR2 PE=1 SV=1
17	P37173	6.95e-91	290	567	0.320	0.289	TGFR2_HUMAN TGF-beta receptor type-2 OS=Homo sapiens OX=9606 GN=TGFBR2 PE=1 SV=2
18	P38438	1.30e-90	290	567	0.320	0.289	TGFR2_RAT TGF-beta receptor type-2 OS=Rattus norvegicus OX=10116 GN=Tgfbr2 PE=1 SV=1
19	Q62312	1.51e-90	290	567	0.320	0.289	TGFR2_MOUSE TGF-beta receptor type-2 OS=Mus musculus OX=10090 GN=Tgfbr2 PE=1 SV=2
20	Q13873	5.62e-88	293	1038	0.324	0.160	BMPR2_HUMAN Bone morphogenetic protein receptor type-2 OS=Homo sapiens OX=9606 GN=BMPR2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01064 Activin_recp	0.0014	30.9	Activin types I and II receptor domain
2	PF01636 APH	2.7e+02	12.8	Phosphotransferase enzyme family
3	PF00069 Pkinase	1e-29	115.3	Protein kinase domain
4	PF17667 Pkinase_fungal	0.015	25.7	Fungal protein kinase
5	PF07714 PK_Tyr_Ser-Thr	1.2e-27	108.4	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000011049

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000017108	0.997	Bone morphogenetic protein 2
2	61853.ENSNLEP00000008592	0.995	Bone morphogenetic protein 7
3	61853.ENSNLEP00000003813	0.992	Inhibin, beta A
4	61853.ENSNLEP00000018756	0.984	Growth differentiation factor 2
5	61853.ENSNLEP00000011633	0.982	Inhibin alpha chain
6	61853.ENSNLEP00000023757	0.981	Bone morphogenetic protein receptor, type IA
7	61853.ENSNLEP00000013966	0.974	Mothers against decapentaplegic homolog
8	61853.ENSNLEP00000015368	0.971	Bone morphogenetic protein 4
9	61853.ENSNLEP00000001001	0.968	Serine/threonine-protein kinase receptor
10	61853.ENSNLEP00000021360	0.968	Growth differentiation factor 11
11	61853.ENSNLEP00000021573	0.963	Serine/threonine-protein kinase receptor
12	61853.ENSNLEP00000015776	0.961	Mothers against decapentaplegic homolog
13	61853.ENSNLEP00000001091	0.960	Inhibin, beta B
14	61853.ENSNLEP00000006554	0.960	Serine/threonine-protein kinase receptor
15	61853.ENSNLEP00000000962	0.959	Receptor protein serine/threonine kinase
16	61853.ENSNLEP00000017197	0.959	Serine/threonine-protein kinase receptor
17	61853.ENSNLEP00000012475	0.949	Growth differentiation factor 5
18	61853.ENSNLEP00000020704	0.949	Receptor protein serine/threonine kinase
19	61853.ENSNLEP00000003942	0.927	Bone morphogenetic protein 5
20	61853.ENSNLEP00000012242	0.921	Bone morphogenetic protein 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0048185	1.000	activin binding
GO:0004675	0.998	transmembrane receptor protein serine/threonine kinase activity
GO:0017002	0.345	activin receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050896	0.983	response to stimulus
GO:0050794	0.983	regulation of cellular process
GO:0023052	0.982	signaling
GO:0032502	0.978	developmental process
GO:0032501	0.978	multicellular organismal process
GO:0048856	0.972	anatomical structure development
GO:0007178	0.971	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0032924	0.963	activin receptor signaling pathway
GO:0010646	0.959	regulation of cell communication
GO:0048513	0.955	animal organ development
GO:0048731	0.955	system development
GO:0048518	0.954	positive regulation of biological process
GO:0023051	0.953	regulation of signaling
GO:0009888	0.939	tissue development
GO:0030154	0.925	cell differentiation
GO:0051239	0.903	regulation of multicellular organismal process
GO:0070848	0.893	response to growth factor
GO:0008152	0.876	metabolic process
GO:0071634	0.875	regulation of transforming growth factor beta production
GO:0080090	0.865	regulation of primary metabolic process
GO:0051171	0.865	regulation of nitrogen compound metabolic process
GO:0001501	0.845	skeletal system development
GO:0031323	0.838	regulation of cellular metabolic process
GO:0048519	0.831	negative regulation of biological process
GO:0048523	0.814	negative regulation of cellular process
GO:0048522	0.811	positive regulation of cellular process
GO:0051094	0.793	positive regulation of developmental process
GO:0061448	0.777	connective tissue development
GO:0009966	0.771	regulation of signal transduction
GO:0009893	0.753	positive regulation of metabolic process
GO:0044237	0.750	cellular metabolic process
GO:0001704	0.736	formation of primary germ layer
GO:0071363	0.731	cellular response to growth factor stimulus
GO:0010604	0.726	positive regulation of macromolecule metabolic process
GO:0023056	0.694	positive regulation of signaling
GO:0010647	0.694	positive regulation of cell communication
GO:0019219	0.693	regulation of nucleobase-containing compound metabolic process
GO:0051240	0.686	positive regulation of multicellular organismal process
GO:0071704	0.676	organic substance metabolic process
GO:0044238	0.668	primary metabolic process
GO:0001707	0.647	mesoderm formation
GO:0006807	0.644	nitrogen compound metabolic process
GO:0009889	0.644	regulation of biosynthetic process
GO:0009967	0.634	positive regulation of signal transduction
GO:0009892	0.619	negative regulation of metabolic process
GO:0008283	0.618	cell population proliferation
GO:0090092	0.617	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048333	0.594	mesodermal cell differentiation
GO:0031326	0.593	regulation of cellular biosynthetic process
GO:0043170	0.590	macromolecule metabolic process
GO:0010556	0.585	regulation of macromolecule biosynthetic process
GO:0071772	0.555	response to BMP
GO:0051252	0.546	regulation of RNA metabolic process
GO:1901564	0.535	organonitrogen compound metabolic process
GO:0010605	0.533	negative regulation of macromolecule metabolic process
GO:0060322	0.516	head development
GO:0006355	0.505	regulation of DNA-templated transcription
GO:0051246	0.501	regulation of protein metabolic process
GO:0007417	0.495	central nervous system development
GO:0051173	0.493	positive regulation of nitrogen compound metabolic process
GO:0045595	0.491	regulation of cell differentiation
GO:0019538	0.491	protein metabolic process
GO:0031325	0.468	positive regulation of cellular metabolic process
GO:0048468	0.464	cell development
GO:0009891	0.425	positive regulation of biosynthetic process
GO:2000026	0.414	regulation of multicellular organismal development
GO:0051254	0.397	positive regulation of RNA metabolic process
GO:0030509	0.388	BMP signaling pathway
GO:0045893	0.385	positive regulation of DNA-templated transcription
GO:0006357	0.369	regulation of transcription by RNA polymerase II
GO:0019220	0.343	regulation of phosphate metabolic process
GO:0031399	0.343	regulation of protein modification process
GO:0090100	0.332	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0006796	0.313	phosphate-containing compound metabolic process
GO:0036211	0.312	protein modification process
GO:0051247	0.311	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.997	intracellular anatomical structure
GO:0005886	0.997	plasma membrane
GO:0005737	0.936	cytoplasm
GO:0032991	0.897	protein-containing complex
GO:0043231	0.655	intracellular membrane-bounded organelle
GO:0005829	0.358	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18673	0.998	ATP + L-seryl-[receptor-protein] = ADP + H(+) + O-phospho-L-seryl-[receptor-protein]
EC:2.7.11.30	0.998	receptor protein serine/threonine kinase.

[back to server]