StarFunc result for job id P27144

User Input

>input (223 residues)
MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEK
SLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLK
DRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKP
VIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P27144	1.000	1.000	3.064E-48	223	1.000	1.000	P27144.pdb.gz	KAD4_HUMAN Adenylate kinase 4, mitochondrial OS=Homo sapiens OX=9606 GN=AK4 PE=1 SV=1
2	PDB:2ar7A	0.748	0.754	2.367E-41	221	0.987	0.995	2ar7A.pdb.gz
3	AFDB:Q9WUS0	0.891	0.891	2.254E-40	223	0.892	0.892	Q9WUS0.pdb.gz	KAD4_RAT Adenylate kinase 4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ak4 PE=2 SV=1
4	PDB:3ndpB	0.739	0.796	1.121E-34	206	0.888	0.961	3ndpB.pdb.gz
5	AFDB:P29411	0.861	0.847	2.112E-30	227	0.543	0.533	P29411.pdb.gz	KAD3_RAT GTP:AMP phosphotransferase AK3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ak3 PE=2 SV=2
6	PDB:6zjbD	0.869	0.888	2.203E-30	218	0.578	0.592	6zjbD.pdb.gz	Structural Basis for GTP versus ATP Selectivity in the NMP Kinase AK3.
7	AFDB:F1R4S7	0.844	0.838	4.540E-30	225	0.574	0.569	F1R4S7.pdb.gz	F1R4S7_DANRE GTP:AMP phosphotransferase AK3, mitochondrial OS=Danio rerio OX=7955 GN=ak3l1 PE=1 SV=1
8	AFDB:Q9VGU6	0.830	0.854	8.425E-27	216	0.457	0.472	Q9VGU6.pdb.gz	Q9VGU6_DROME GTP:AMP phosphotransferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Ak3 PE=1 SV=1
9	AFDB:Q5BGS1	0.809	0.769	8.807E-24	236	0.390	0.369	Q5BGS1.pdb.gz	Q5BGS1_EMENI GTP:AMP phosphotransferase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ADK2 PE=3 SV=1
10	AFDB:P26364	0.756	0.750	2.604E-23	225	0.399	0.396	P26364.pdb.gz	KAD3_YEAST GTP:AMP phosphotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADK2 PE=1 SV=1
11	AFDB:Q38BZ2	0.815	0.818	1.881E-22	222	0.354	0.356	Q38BZ2.pdb.gz	Q38BZ2_TRYB2 Adenylate kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5150 PE=3 SV=1
12	PDB:2c9yA	0.704	0.718	3.047E-21	218	0.377	0.385	2c9yA.pdb.gz	Structure of Human Adenylate Kinase 2
13	AFDB:P33075	0.778	0.787	4.282E-21	220	0.363	0.368	P33075.pdb.gz	KAD2_SCHPO Adenylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=adk1 PE=1 SV=1
14	PDB:3tlxB	0.773	0.723	5.410E-21	240	0.354	0.329	3tlxB.pdb.gz	Crystal Structure of PF10_0086, adenylate kinase from plasmodium falciparum
15	AFDB:I1XB05	0.776	0.721	8.637E-21	242	0.354	0.326	I1XB05.pdb.gz	I1XB05_HELAM Adenylate kinase OS=Helicoverpa armigera OX=29058 GN=AK2 PE=2 SV=1
16	PDB:1akeA	0.694	0.720	2.186E-19	214	0.345	0.360	1akeA.pdb.gz	Structure of the complex between adenylate kinase from Escherichia coli and the inhibitor Ap5A refined at 1.9 A resolution. A model for a catalytic transition state.
17	PDB:1dvrA	0.771	0.780	4.137E-19	220	0.341	0.345	1dvrA.pdb.gz	Structure of a mutant adenylate kinase ligated with an ATP-analogue showing domain closure over ATP.
18	PDB:2c95A	0.694	0.785	9.781E-14	195	0.229	0.262	2c95A.pdb.gz	Structure of Adenylate Kinase 1 in Complex with P1, P4-Di(Adenosine)Tetraphosphate
19	PDB:1ukyA	0.701	0.788	1.973E-13	196	0.229	0.260	1ukyA.pdb.gz	Substrate specificity and assembly of the catalytic center derived from two structures of ligated uridylate kinase.
20	PDB:1qf9A	0.690	0.781	1.725E-12	194	0.242	0.278	1qf9A.pdb.gz	pH influences fluoride coordination number of the AlFx phosphoryl transfer transition state analog.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P27144	1.48e-168	464	223	1.000	1.000	KAD4_HUMAN Adenylate kinase 4, mitochondrial OS=Homo sapiens OX=9606 GN=AK4 PE=1 SV=1
2	Q9WUR9	1.01e-152	424	223	0.901	0.901	KAD4_MOUSE Adenylate kinase 4, mitochondrial OS=Mus musculus OX=10090 GN=Ak4 PE=1 SV=1
3	Q9WUS0	3.27e-152	423	223	0.892	0.892	KAD4_RAT Adenylate kinase 4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ak4 PE=2 SV=1
4	F8VS11	2.54e-127	358	171	0.767	1.000	F8VS11_HUMAN Adenylate kinase 8 OS=Homo sapiens OX=9606 GN=AK4 PE=1 SV=1
5	Q9UIJ7	7.98e-98	286	227	0.592	0.581	KAD3_HUMAN GTP:AMP phosphotransferase AK3, mitochondrial OS=Homo sapiens OX=9606 GN=AK3 PE=1 SV=4
6	Q9WTP7	1.43e-94	277	227	0.561	0.551	KAD3_MOUSE GTP:AMP phosphotransferase AK3, mitochondrial OS=Mus musculus OX=10090 GN=Ak3 PE=1 SV=3
7	F1R4S7	2.19e-94	277	225	0.570	0.564	F1R4S7_DANRE GTP:AMP phosphotransferase AK3, mitochondrial OS=Danio rerio OX=7955 GN=ak3l1 PE=1 SV=1
8	P29411	4.63e-89	263	227	0.543	0.533	KAD3_RAT GTP:AMP phosphotransferase AK3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ak3 PE=2 SV=2
9	Q9VGU6	2.87e-74	226	216	0.462	0.477	Q9VGU6_DROME GTP:AMP phosphotransferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Ak3 PE=1 SV=1
10	Q5BGS1	2.36e-51	168	236	0.399	0.377	Q5BGS1_EMENI GTP:AMP phosphotransferase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ADK2 PE=3 SV=1
11	P26364	3.42e-51	167	225	0.381	0.378	KAD3_YEAST GTP:AMP phosphotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADK2 PE=1 SV=1
12	P54819	5.08e-49	162	239	0.386	0.360	KAD2_HUMAN Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 PE=1 SV=2
13	Q38BZ2	2.84e-47	157	222	0.359	0.360	Q38BZ2_TRYB2 Adenylate kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5150 PE=3 SV=1
14	Q9WTP6	6.18e-47	157	239	0.372	0.347	KAD2_MOUSE Adenylate kinase 2, mitochondrial OS=Mus musculus OX=10090 GN=Ak2 PE=1 SV=5
15	P29410	8.01e-47	156	239	0.363	0.339	KAD2_RAT Adenylate kinase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ak2 PE=2 SV=2
16	P33075	3.41e-46	154	220	0.350	0.355	KAD2_SCHPO Adenylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=adk1 PE=1 SV=1
17	Q5B2V8	4.28e-46	155	259	0.363	0.313	KAD2_EMENI Adenylate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=adk1 PE=3 SV=1
18	O82514	5.20e-46	154	246	0.341	0.309	KAD4_ARATH Adenylate kinase 4 OS=Arabidopsis thaliana OX=3702 GN=ADK1 PE=1 SV=2
19	Q9FK35	6.46e-46	154	248	0.350	0.315	KAD3_ARATH Adenylate kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ADK2 PE=1 SV=1
20	I1XB05	1.35e-45	153	242	0.354	0.326	I1XB05_HELAM Adenylate kinase OS=Helicoverpa armigera OX=29058 GN=AK2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	34	16.3	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	1.5e+02	14.1	AAA ATPase domain
3	PF13207 AAA_17	1.4e-17	75.9	AAA domain
4	PF13238 AAA_18	1.4e-06	40.3	AAA domain
5	PF13401 AAA_22	2.2e+02	13.5	AAA domain
6	PF13521 AAA_28	94	14.7	AAA domain
7	PF13671 AAA_33	1.5	20.4	AAA domain
8	PF07728 AAA_5	3.3e+02	12.7	AAA domain (dynein-related subfamily)
9	PF00005 ABC_tran	3.5e+02	13.1	ABC transporter
10	PF00406 ADK	5.9e-47	171.0	Adenylate kinase
11	PF05191 ADK_lid	2e-11	54.9	Adenylate kinase, active site lid
12	PF03029 ATP_bind_1	5.9e+02	11.6	Conserved hypothetical ATP binding protein
13	PF02224 Cytidylate_kin	0.011	27.1	Cytidylate kinase
14	PF01712 dNK	3.1e+02	12.6	Deoxynucleoside kinase
15	PF05729 NACHT	2.1e+02	13.3	NACHT domain
16	PF03266 NTPase_1	2.1e+02	13.2	NTPase
17	PF05496 RuvB_N	4.1e+02	12.1	Holliday junction DNA helicase RuvB P-loop domain
18	PF01202 SKI	70	15.0	Shikimate kinase
19	PF02223 Thymidylate_kin	7	17.8	Thymidylate kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378743

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286621	0.958	Adenosine kinase
2	9606.ENSP00000367615	0.948	Adenine phosphoribosyltransferase
3	9606.ENSP00000485525	0.930	Adenylosuccinate lyase
4	9606.ENSP00000286648	0.918	Deoxycytidine kinase
5	9606.ENSP00000300738	0.917	Ribonucleoside-diphosphate reductase large subunit
6	9606.ENSP00000219479	0.910	Nucleoside diphosphate kinase, mitochondrial
7	9606.ENSP00000251810	0.910	Ribonucleoside-diphosphate reductase subunit M2 B
8	9606.ENSP00000355587	0.903	Cancer-related nucleoside-triphosphatase
9	9606.ENSP00000353165	0.902	Thiamin pyrophosphokinase 1
10	9606.ENSP00000353770	0.902	Ribonucleoside-diphosphate reductase subunit M2
11	9606.ENSP00000347213	0.900	Ectonucleoside triphosphate diphosphohydrolase 2
12	9606.ENSP00000373674	0.897	5'(3')-deoxyribonucleotidase, mitochondrial
13	9606.ENSP00000410186	0.784	Adenylate kinase 9
14	9606.ENSP00000416658	0.766	Nucleoside diphosphate kinase 6
15	9606.ENSP00000376889	0.739	Nucleoside diphosphate kinase
16	9606.ENSP00000376886	0.736	Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity). Negatively regulates Rho activity by interacting with AKAP13/LBC . Acts as a transcriptional activator of the MYC gene
17	9606.ENSP00000389948	0.732	7-methylguanosine phosphate-specific 5'-nucleotidase
18	9606.ENSP00000320171	0.729	Pyruvate kinase PKM
19	9606.ENSP00000337060	0.721	Nucleoside diphosphate kinase A
20	9606.ENSP00000263556	0.719	Prolyl 4-hydroxylase subunit alpha-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004017	0.999	adenylate kinase activity
GO:0005515	0.998	protein binding
GO:0004550	0.997	nucleoside diphosphate kinase activity
GO:0043167	0.558	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006753	0.987	nucleoside phosphate metabolic process
GO:0009117	0.980	nucleotide metabolic process
GO:1901564	0.947	organonitrogen compound metabolic process
GO:0050896	0.902	response to stimulus
GO:0006163	0.902	purine nucleotide metabolic process
GO:0009259	0.888	ribonucleotide metabolic process
GO:0050789	0.885	regulation of biological process
GO:0009150	0.870	purine ribonucleotide metabolic process
GO:0050794	0.833	regulation of cellular process
GO:0009123	0.826	nucleoside monophosphate metabolic process
GO:0009141	0.818	nucleoside triphosphate metabolic process
GO:0009126	0.764	purine nucleoside monophosphate metabolic process
GO:0009161	0.684	ribonucleoside monophosphate metabolic process
GO:0009167	0.663	purine ribonucleoside monophosphate metabolic process
GO:0042221	0.595	response to chemical
GO:1901293	0.529	nucleoside phosphate biosynthetic process
GO:0046033	0.503	AMP metabolic process
GO:0009199	0.345	ribonucleoside triphosphate metabolic process
GO:0009205	0.343	purine ribonucleoside triphosphate metabolic process
GO:0009132	0.334	nucleoside diphosphate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070013	1.000	intracellular organelle lumen
GO:0005739	0.992	mitochondrion
GO:0005759	0.972	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12973	0.999	AMP + ATP = 2 ADP
EC:2.7.4.3	0.999	adenylate kinase.
EC:2.7.4.6	0.997	nucleoside-diphosphate kinase.

[back to server]