StarFunc result for job id P27216

User Input

>input (316 residues)
MGNRHAKASSPQGFDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATY
GKELEEVLKSELSGNFEKTALALLDRPSEYAARQLQKAMKGLGTDESVLIEVLCTRTNKE
IIAIKEAYQRLFDRSLESDVKGDTSGNLKKILVSLLQANRNEGDDVDKDLAGQDAKDLYD
AGEGRWGTDELAFNEVLAKRSYKQLRATFQAYQILIGKDIEEAIEEETSGDLQKAYLTLV
RCAQDCEDYFAERLYKSMKGAGTDEETLIRIVVTRAEVDLQGIKAKFQEKYQKSLSDMVR
SDTSGDFRKLLVALLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P27216	1.000	1.000	1.367E-43	316	1.000	1.000	P27216.pdb.gz	ANX13_HUMAN Annexin A13 OS=Homo sapiens OX=9606 GN=ANXA13 PE=1 SV=3
2	PDB:6b3iA	0.888	0.922	3.310E-33	304	0.956	0.993	6b3iA.pdb.gz
3	AFDB:P20072	0.963	0.659	3.547E-30	463	0.503	0.343	P20072.pdb.gz	ANXA7_BOVIN Annexin A7 OS=Bos taurus OX=9913 GN=ANXA7 PE=1 SV=2
4	AFDB:P20073	0.962	0.625	1.072E-29	488	0.491	0.318	P20073.pdb.gz	ANXA7_HUMAN Annexin A7 OS=Homo sapiens OX=9606 GN=ANXA7 PE=1 SV=3
5	AFDB:Q27512	0.958	0.613	3.510E-28	497	0.449	0.286	Q27512.pdb.gz	Q27512_CAEEL Annexin OS=Caenorhabditis elegans OX=6239 GN=nex-2 PE=1 SV=2
6	AFDB:P50995	0.967	0.609	3.988E-28	505	0.475	0.297	P50995.pdb.gz	ANX11_HUMAN Annexin A11 OS=Homo sapiens OX=9606 GN=ANXA11 PE=1 SV=1
7	AFDB:P09525	0.957	0.948	4.342E-28	319	0.462	0.458	P09525.pdb.gz	ANXA4_HUMAN Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 PE=1 SV=4
8	AFDB:P13928	0.954	0.922	4.728E-28	327	0.481	0.465	P13928.pdb.gz	ANXA8_HUMAN Annexin A8 OS=Homo sapiens OX=9606 GN=ANXA8 PE=1 SV=3
9	AFDB:P22464	0.942	0.919	1.107E-27	324	0.478	0.466	P22464.pdb.gz	ANXB9_DROME Annexin B9 OS=Drosophila melanogaster OX=7227 GN=AnxB9 PE=1 SV=2
10	AFDB:B5XEI6	0.957	0.948	1.258E-27	319	0.472	0.467	B5XEI6.pdb.gz	B5XEI6_SALSA Annexin OS=Salmo salar OX=8030 GN=ANXA4 PE=2 SV=1
11	AFDB:B5XAE0	0.944	0.941	1.429E-27	317	0.440	0.438	B5XAE0.pdb.gz	B5XAE0_SALSA Annexin OS=Salmo salar OX=8030 GN=ANXA5 PE=2 SV=1
12	PDB:2zocA	0.970	0.961	5.820E-27	319	0.465	0.461	2zocA.pdb.gz	The comparison of the loop structure of membrane binding sites between human and bovine annexin IV
13	PDB:2h0kA	0.936	0.930	1.150E-26	318	0.427	0.425	2h0kA.pdb.gz	Annexin-A5 assembled into two-dimensional arrays promotes cell membrane repair.
14	PDB:1axnA	0.926	0.907	1.915E-26	323	0.421	0.412	1axnA.pdb.gz	The high-resolution crystal structure of human annexin III shows subtle differences with annexin V.
15	PDB:1w45A	0.938	0.927	5.318E-26	320	0.481	0.475	1w45A.pdb.gz
16	PDB:7qqnC	0.939	0.719	2.075E-25	414	0.418	0.319	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	PDB:7p70A	0.969	0.755	2.916E-25	407	0.421	0.327	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
18	PDB:7p73A	0.968	0.731	3.043E-25	420	0.421	0.317	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
19	PDB:7pc3A	0.947	0.741	3.457E-25	405	0.421	0.328	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:1ainA	0.955	0.961	4.462E-25	314	0.430	0.433	1ainA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P27216	0.0	638	316	1.000	1.000	ANX13_HUMAN Annexin A13 OS=Homo sapiens OX=9606 GN=ANXA13 PE=1 SV=3
2	Q29471	0.0	583	316	0.911	0.911	ANX13_CANLF Annexin A13 OS=Canis lupus familiaris OX=9615 GN=ANXA13 PE=1 SV=2
3	Q6IRJ7	1.26e-108	325	463	0.506	0.346	Q6IRJ7_RAT Annexin OS=Rattus norvegicus OX=10116 GN=Anxa7 PE=3 SV=1
4	A0A8I6A9P3	1.30e-108	326	475	0.506	0.337	A0A8I6A9P3_RAT Annexin OS=Rattus norvegicus OX=10116 GN=Anxa7 PE=1 SV=1
5	F7F6D1	2.49e-108	325	485	0.506	0.330	F7F6D1_RAT Annexin OS=Rattus norvegicus OX=10116 GN=Anxa7 PE=1 SV=1
6	A0A8I5ZM12	4.07e-108	325	495	0.506	0.323	A0A8I5ZM12_RAT Annexin OS=Rattus norvegicus OX=10116 GN=Anxa7 PE=1 SV=1
7	P20072	2.99e-107	322	463	0.506	0.346	ANXA7_BOVIN Annexin A7 OS=Bos taurus OX=9913 GN=ANXA7 PE=1 SV=2
8	Q07076	1.21e-106	320	463	0.506	0.346	ANXA7_MOUSE Annexin A7 OS=Mus musculus OX=10090 GN=Anxa7 PE=1 SV=2
9	P20073	4.07e-106	320	488	0.491	0.318	ANXA7_HUMAN Annexin A7 OS=Homo sapiens OX=9606 GN=ANXA7 PE=1 SV=3
10	A0A8I6AH11	1.59e-99	302	458	0.472	0.325	A0A8I6AH11_RAT Annexin OS=Rattus norvegicus OX=10116 GN=Anxa7 PE=1 SV=1
11	P13928	9.15e-99	295	327	0.481	0.465	ANXA8_HUMAN Annexin A8 OS=Homo sapiens OX=9606 GN=ANXA8 PE=1 SV=3
12	P13214	2.07e-98	294	319	0.472	0.467	ANXA4_BOVIN Annexin A4 OS=Bos taurus OX=9913 GN=ANXA4 PE=1 SV=2
13	P09525	3.13e-98	294	319	0.465	0.461	ANXA4_HUMAN Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 PE=1 SV=4
14	P97429	3.38e-98	294	319	0.484	0.480	ANXA4_MOUSE Annexin A4 OS=Mus musculus OX=10090 GN=Anxa4 PE=1 SV=4
15	B5XEI6	1.99e-97	292	319	0.472	0.467	B5XEI6_SALSA Annexin OS=Salmo salar OX=8030 GN=ANXA4 PE=2 SV=1
16	P50995	1.71e-96	296	505	0.478	0.299	ANX11_HUMAN Annexin A11 OS=Homo sapiens OX=9606 GN=ANXA11 PE=1 SV=1
17	Q5T0G8	1.71e-96	296	505	0.478	0.299	Q5T0G8_HUMAN Annexin OS=Homo sapiens OX=9606 GN=ANXA11 PE=1 SV=1
18	P33477	3.40e-96	295	503	0.475	0.298	ANX11_RABIT Annexin A11 OS=Oryctolagus cuniculus OX=9986 GN=ANXA11 PE=1 SV=1
19	P22464	1.63e-95	287	324	0.478	0.466	ANXB9_DROME Annexin B9 OS=Drosophila melanogaster OX=7227 GN=AnxB9 PE=1 SV=2
20	P97384	2.85e-95	293	503	0.468	0.294	ANX11_MOUSE Annexin A11 OS=Mus musculus OX=10090 GN=Anxa11 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13720 Acetyltransf_11	51	15.7	Udp N-acetylglucosamine O-acyltransferase; Domain 2
2	PF00191 Annexin	3.7e-96	326.5	Annexin
3	PF00857 Isochorismatase	3e+02	13.0	Isochorismatase family
4	PF15963 Myb_DNA-bind_7	0.00066	30.8	Myb DNA-binding like
5	PF01092 Ribosomal_S6e	11	17.3	Ribosomal protein S6e
6	PF04546 Sigma70_ner	94	14.4	Sigma-70, non-essential region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003820525.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003827919.1	0.825	Neural precursor cell expressed, developmentally down-regulated 4, E3 ubiquitin protein ligase
2	9597.XP_008958524.1	0.734	Dysferlin
3	9597.XP_003817272.1	0.688	Belongs to the S-100 family.
4	9597.XP_003823509.1	0.675	Belongs to the peptidase C14A family.
5	9597.XP_003823386.1	0.652	CUB and sushi domain-containing protein 3 isoform X1
6	9597.XP_008950879.1	0.621	Neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase
7	9597.XP_003806305.1	0.583	Belongs to the peptidase C14A family.
8	9597.XP_003820792.1	0.577	Belongs to the peptidase C14A family.
9	9597.XP_003832390.1	0.568	Serum albumin
10	9597.XP_003823375.1	0.551	Belongs to the glycosyltransferase 47 family.
11	9597.XP_008975215.1	0.551	Transcriptional repressor GATA binding 1
12	9597.XP_003818285.1	0.541	Tumor susceptibility 101
13	9597.XP_003814810.1	0.537	BCL2 like 1
14	9597.XP_008967335.1	0.533	CD81 molecule
15	9597.XP_003807589.1	0.526	CD63 molecule
16	9597.XP_003829684.1	0.526	C-type lectin domain family 7 member A isoform X1
17	9597.XP_003825414.1	0.520	Myoferlin isoform X1
18	9597.XP_008971996.1	0.516	CD9 molecule

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005544	0.999	calcium-dependent phospholipid binding
GO:0005515	0.997	protein binding
GO:0001786	0.984	phosphatidylserine binding
GO:0043167	0.975	ion binding
GO:0043168	0.974	anion binding
GO:0046872	0.940	metal ion binding
GO:0005509	0.923	calcium ion binding
GO:1901611	0.778	phosphatidylglycerol binding
GO:0042802	0.612	identical protein binding
GO:0035091	0.423	phosphatidylinositol binding
GO:0048306	0.329	calcium-dependent protein binding
GO:0097159	0.317	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.969	regulation of biological process
GO:0009987	0.962	cellular process
GO:0048518	0.951	positive regulation of biological process
GO:0032880	0.908	regulation of protein localization
GO:1904375	0.878	regulation of protein localization to cell periphery
GO:1905475	0.875	regulation of protein localization to membrane
GO:1903828	0.827	negative regulation of protein localization
GO:0060627	0.807	regulation of vesicle-mediated transport
GO:0048522	0.796	positive regulation of cellular process
GO:0070201	0.741	regulation of establishment of protein localization
GO:0051223	0.725	regulation of protein transport
GO:0050896	0.604	response to stimulus
GO:1903076	0.576	regulation of protein localization to plasma membrane
GO:0032501	0.367	multicellular organismal process
GO:0032502	0.346	developmental process
GO:0051050	0.342	positive regulation of transport
GO:0051179	0.337	localization
GO:0060255	0.337	regulation of macromolecule metabolic process
GO:0048856	0.326	anatomical structure development
GO:0051716	0.326	cellular response to stimulus
GO:1904950	0.312	negative regulation of establishment of protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0031982	0.999	vesicle
GO:0005886	0.997	plasma membrane
GO:0043233	0.989	organelle lumen
GO:0070013	0.984	intracellular organelle lumen
GO:0012505	0.973	endomembrane system
GO:0043231	0.972	intracellular membrane-bounded organelle
GO:0005737	0.969	cytoplasm
GO:0005634	0.955	nucleus
GO:0005576	0.952	extracellular region
GO:0031981	0.908	nuclear lumen
GO:0065010	0.855	extracellular membrane-bounded organelle
GO:1903561	0.834	extracellular vesicle
GO:0070062	0.819	extracellular exosome
GO:0005829	0.730	cytosol
GO:0005654	0.438	nucleoplasm
GO:0019898	0.394	extrinsic component of membrane
GO:0097708	0.369	intracellular vesicle
GO:0031410	0.364	cytoplasmic vesicle
GO:0031090	0.337	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]